KEGG   Homo sapiens (human): 6890Help
Entry
6890              CDS       T01001                                 

Gene name
TAP1, ABC17, ABCB2, APT1, D6S114E, PSF-1, PSF1, RING4, TAP1*0102N, TAP1N
Definition
transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Orthology
K05653  
ATP-binding cassette, subfamily B (MDR/TAP), member 2
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Phagosome
Antigen processing and presentation
Herpes simplex infection
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
H00984  
Bare lymphocyte syndrome (BLS) type1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    6890 (TAP1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    6890 (TAP1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    6890 (TAP1)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    6890 (TAP1)
  Infectious diseases
   05168 Herpes simplex infection
    6890 (TAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 808 aa AA seqDB search
MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVP
MASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAV
GLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWG
APGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCL
GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAV
LEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLS
ENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL
AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGM
LLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFE
YLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPN
GSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIA
YGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRK
PCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAI
REGGTHQQLMEKKGCYWAMVQAPADAPE
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcttctcgccagcgcaggatcagcctgttcctgggactttccgagagccccg
ccctcgttccctcccccagccgccagtaggggaggactcggcggtacccggagcttcagg
ccccaccggggcgcggagagtcccaggcccggccgggaccgggacggcgtccgagtgcca
atggctagctctaggtgtcccgctccccgcgggtgccgctgcctccccggagcttctctc
gcatggctggggacagtactgctacttctcgccgactgggtgctgctccggaccgcgctg
ccccgcatattctccctgctggtgcccaccgcgctgccactgctccgggtctgggcggtg
ggcctgagccgctgggccgtgctctggctgggggcctgcggggtcctcagggcaacggtt
ggctccaagagcgaaaacgcaggtgcccagggctggctggctgctttgaagccattagct
gcggcactgggcttggccctgccgggacttgccttgttccgagagctgatctcatgggga
gcccccgggtccgcggatagcaccaggctactgcactggggaagtcaccctaccgccttc
gttgtcagttatgcagcggcactgcccgcagcagccctgtggcacaaactcgggagcctc
tgggtgcccggcggtcagggcggctctggaaaccctgtgcgtcggcttctaggctgcctg
ggctcggagacgcgccgcctctcgctgttcctggtcctggtggtcctctcctctcttggg
gagatggccattccattctttacgggccgcctcactgactggattctacaagatggctca
gccgataccttcactcgaaacttaactctcatgtccattctcaccatagccagtgcagtg
ctggagttcgtgggtgacgggatctataacaacaccatgggccacgtgcacagccacttg
cagggagaggtgtttggggctgtcctgcgccaggagacggagtttttccaacagaaccag
acaggtaacatcatgtctcgggtaacagaggacacgtccaccctgagtgattctctgagt
gagaatctgagcttatttctgtggtacctggtgcgaggcctatgtctcttggggatcatg
ctctggggatcagtgtccctcaccatggtcaccctgatcaccctgcctctgcttttcctt
ctgcccaagaaggtgggaaaatggtaccagttgctggaagtgcaggtgcgggaatctctg
gcaaagtccagccaggtggccattgaggctctgtcggccatgcctacagttcgaagcttt
gccaacgaggagggcgaagcccagaagtttagggaaaagctgcaagaaataaagacactc
aaccagaaggaggctgtggcctatgcagtcaactcctggaccactagtatttcaggtatg
ctgctgaaagtgggaatcctctacattggtgggcagctggtgaccagtggggctgtaagc
agtgggaaccttgtcacatttgttctctaccagatgcagttcacccaggctgtggaggta
ctgctctccatctaccccagagtacagaaggctgtgggctcctcagagaaaatatttgag
tacctggaccgcacccctcgctgcccacccagtggtctgttgactcccttacacttggag
ggccttgtccagttccaagatgtctcctttgcctacccaaaccgcccagatgtcttagtg
ctacaggggctgacattcaccctacgccctggcgaggtgacggcgctggtgggacccaat
gggtctgggaagagcacagtggctgccctgctgcagaatctgtaccagcccaccggggga
cagctgctgttggatgggaagccccttccccaatatgagcaccgctacctgcacaggcag
gtggctgcagtgggacaagagccacaggtatttggaagaagtcttcaagaaaatattgcc
tatggcctgacccagaagccaactatggaggaaatcacagctgctgcagtaaagtctggg
gcccatagtttcatctctggactccctcagggctatgacacagaggtagacgaggctggg
agccagctgtcagggggtcagcgacaggcagtggcgttggcccgagcattgatccggaaa
ccgtgtgtacttatcctggatgatgccaccagtgccctggatgcaaacagccagttacag
gtggagcagctcctgtacgaaagccctgagcggtactcccgctcagtgcttctcatcacc
cagcacctcagcctggtggagcaggctgaccacatcctctttctggaaggaggcgctatc
cgggaggggggaacccaccagcagctcatggagaaaaaggggtgctactgggccatggtg
caggctcctgcagatgctccagaatga

DBGET integrated database retrieval system