KEGG   Homo sapiens (human): 6921Help
Entry
6921              CDS       T01001                                 

Gene name
TCEB1, SIII, eloC
Definition
transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
Orthology
K03872  
transcription elongation factor B, polypeptide 1
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Pathways in cancer
Renal cell carcinoma
Module
ECV complex
ECS complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6921 (TCEB1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    6921 (TCEB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6921 (TCEB1)
   05211 Renal cell carcinoma
    6921 (TCEB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECV complex
    adoptor protein
     6921 (TCEB1)
   ECS complex
     6921 (TCEB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.11
AA seq 112 aa AA seqDB search
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggacctgatgccatgtatgtcaaa
ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc
acgataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaaccaatgaggtc
aattttagagagataccttcacatgtgctatcgaaagtatgcatgtattttacgtacaag
gttcgctacactaacagctccaccgagattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggctgcgaacttcttagattgttaa

DBGET integrated database retrieval system