KEGG   Homo sapiens (human): 6921Help
Entry
6921              CDS       T01001                                 

Gene name
TCEB1, SIII, eloC
Definition
transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
Orthology
K03872  
transcription elongation factor B, polypeptide 1
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Pathways in cancer
Renal cell carcinoma
Module
ECV complex
ECS complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.11
AA seq 112 aa AA seqDB search
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggacctgatgccatgtatgtcaaa
ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc
acgataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaaccaatgaggtc
aattttagagagataccttcacatgtgctatcgaaagtatgcatgtattttacgtacaag
gttcgctacactaacagctccaccgagattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggctgcgaacttcttagattgttaa

DBGET integrated database retrieval system