KEGG   Homo sapiens (human): 6923Help
Entry
6923              CDS       T01001                                 

Gene name
TCEB2, ELOB, SIII
Definition
transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Orthology
K03873  
transcription elongation factor B, polypeptide 2
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Pathways in cancer
Renal cell carcinoma
Module
ECV complex
ECS complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6923 (TCEB2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    6923 (TCEB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6923 (TCEB2)
   05211 Renal cell carcinoma
    6923 (TCEB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECV complex
    adoptor protein
     6923 (TCEB2)
   ECS complex
     6923 (TCEB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.3
AA seq 118 aa AA seqDB search
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag
tccagcacggtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggcctcctgac
gagcagcggctgtacaaggatgaccaactcttggatgatggcaagacactgggcgagtgt
ggcttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccgg
gcagatgacacctttgaggccctgtgcatcgagccgttttccagcccgccagagctgccc
gatgtgatgaagccccaggactcgggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system