KEGG   Homo sapiens (human): 6923Help
Entry
6923              CDS       T01001                                 

Gene name
TCEB2, ELOB, SIII
Definition
transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Orthology
K03873  
transcription elongation factor B, polypeptide 2
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Pathways in cancer
Renal cell carcinoma
Module
ECV complex
ECS complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.3
AA seq 118 aa AA seqDB search
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag
tccagcacggtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggcctcctgac
gagcagcggctgtacaaggatgaccaactcttggatgatggcaagacactgggcgagtgt
ggcttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccgg
gcagatgacacctttgaggccctgtgcatcgagccgttttccagcccgccagagctgccc
gatgtgatgaagccccaggactcgggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system