KEGG   Homo sapiens (human): 6948Help
Entry
6948              CDS       T01001                                 

Gene name
TCN2, D22S676, D22S750, II, TC, TC_II, TC-2, TC2, TCII
Definition
transcobalamin II
Orthology
K14619  
transcobalamin-2
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H01190  
Transcobalamin II deficiency
Class
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 427 aa AA seqDB search
MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRL
SSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVR
GHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLL
YAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPEGHF
GNVYSTPLALQFLMTSPMRGAELGTACLKARVALLASLQDGAFQNALMISQLLPVLNHKT
YIDLIFPDCLAPRVMLEPAAETIPQTQEIISVTLQVLSLLPPYRQSISVLAGSTVEDVLK
KAHELGGFTYETQASLSGPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADYRPKDGETI
ELRLVSW
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaccttggggccttcctcttccttctgggggtcctgggggccctcactgagatg
tgtgaaataccagagatggacagccatctggtagagaagttgggccagcacctcttacct
tggatggaccggctttccctggagcacttgaaccccagcatctatgtgggcctacgcctc
tccagtctgcaggctgggaccaaggaagacctctacctgcacagcctcaagcttggttac
cagcagtgcctcctagggtctgccttcagcgaggatgacggtgactgccagggcaagcct
tccatgggccagctggccctctacctgctcgctctcagagccaactgtgagtttgtcagg
ggccacaagggggacaggctggtctcacagctcaaatggttcctggaggatgagaagaga
gccattgggcatgatcacaagggccacccccacactagctactaccagtatggcctgggc
attctggccctgtgtctccaccagaagcgggtccatgacagcgtggtggacaaacttctg
tatgctgtggaacctttccaccagggccaccattctgtggacacagcagccatggcaggc
ttggcattcacctgtctgaagcgctcaaacttcaaccctggtcggagacaacggatcacc
atggccatcagaacagtgcgagaggagatcttgaaggcccagacccccgagggccacttt
gggaatgtctacagcaccccattggcattacagttcctcatgacttcccccatgcgtggg
gcagaactgggaacagcatgtctcaaggcgagggttgctttgctggccagtctgcaggat
ggagccttccagaatgctctcatgatttcccagctgctgcccgttctgaaccacaagacc
tacattgatctgatcttcccagactgtctggcaccacgagtcatgttggaaccagctgct
gagaccattcctcagacccaagagatcatcagtgtcacgctgcaggtgcttagtctcttg
ccgccgtacagacagtccatctctgttctggccgggtccaccgtggaagatgtcctgaag
aaggcccatgagttaggaggattcacatatgaaacacaggcctccttgtcaggcccctac
ttaacctccgtgatggggaaagcggccggagaaagggagttctggcagcttctccgagac
cccaacaccccactgttgcaaggtattgctgactacagacccaaggatggagaaaccatt
gagctgaggctggttagctggtag

DBGET integrated database retrieval system