KEGG   Homo sapiens (human): 6999Help
Entry
6999              CDS       T01001                                 

Gene name
TDO2, TDO, TO, TPH2, TRPO
Definition
tryptophan 2,3-dioxygenase (EC:1.13.11.11)
Orthology
K00453  
tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    6999 (TDO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     6999 (TDO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31-q32
AA seq 406 aa AA seqDB search
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggtgcccatttttaggaaacaactttggatatacttttaaaaaactccccgta
gaaggcagcgaagaagacaaatcacaaactggtgtgaatagagccagcaaaggaggtctt
atctatgggaactacctgcatttggaaaaagttttgaatgcacaagaactgcaaagtgaa
acaaaaggaaataaaatccatgatgaacatctttttatcataactcatcaagcttatgaa
ctctggtttaagcaaatcctctgggagttggattctgttcgagagatctttcagaatggc
catgtcagagatgaaaggaacatgcttaaggttgtttctcggatgcaccgagtgtcagtg
atcctgaaactgctggtgcagcagttttccattctggagacgatgacagccttggacttc
aatgacttcagagagtacttatctccagcatcaggcttccagagtttgcaattccgacta
ttagaaaacaagataggtgttcttcagaacatgagagtcccttataacagaagacattat
cgtgataacttcaaaggagaagaaaatgaactgctacttaaatctgagcaggaaaagaca
cttctggaattagtggaggcatggctggaaagaactccaggtttagagccacatggattt
aacttctggggaaagcttgaaaaaaatatcaccagaggcctggaagaggaattcataagg
attcaggctaaagaagagtctgaagaaaaagaggaacaggtggctgaatttcagaagcaa
aaagaggtgctactgtccttatttgatgagaaacgtcatgaacatctccttagtaaaggt
gaaagacggctgtcatacagagcacttcagggagcattgatgatatatttttacagggaa
gagcctaggttccaggtgccttttcagttgctgacttctcttatggacatagattcactg
atgaccaaatggagatataaccatgtgtgcatggtgcacagaatgctgggcagcaaagct
ggcaccggtggttcctcaggctatcactacctgcgatcaactgtgagtgataggtacaag
gtatttgtagatttatttaatctttcaacatacctgattccccgacactggataccgaag
atgaacccaaccattcacaaatttctatatacagcagaatactgtgatagctcctacttc
agcagtgatgaatcagattaa

DBGET integrated database retrieval system