KEGG   Homo sapiens (human): 7019Help
Entry
7019              CDS       T01001                                 

Gene name
TFAM, MTDPS15, MTTF1, MTTFA, TCF6, TCF6L1, TCF6L2, TCF6L3
Definition
(RefSeq) transcription factor A, mitochondrial
  KO
K11830  
transcription factor A, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
Apelin signaling pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    7019 (TFAM)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    7019 (TFAM)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    7019 (TFAM)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    7019 (TFAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q00059(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q21.1
AA seq 246 aa AA seqDB search
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRF
SKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQ
LTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQE
KLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRK
YGAEEC
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttctccgaagcatgtggggcgtgctgagtgccctgggaaggtctggagcagag
ctgtgcaccggctgtggaagtcgactgcgctcccccttcagttttgtgtatttaccgagg
tggttttcatctgtcttggcaagttgtccaaagaaacctgtaagttcttaccttcgattt
tctaaagaacaactacccatatttaaagctcagaacccagatgcaaaaactacagaacta
attagaagaattgcccagcgttggagggaacttcctgattcaaagaaaaaaatatatcaa
gatgcttatagggcggagtggcaggtatataaagaagagataagcagatttaaagaacag
ctaactccaagtcagattatgtctttggaaaaagaaatcatggacaaacatttaaaaagg
aaagctatgacaaaaaaaaaagagttaacactgcttggaaaaccaaaaagacctcgttca
gcttataacgtttatgtagctgaaagattccaagaagctaagggtgattcaccgcaggaa
aagctgaagactgtaaaggaaaactggaaaaatctgtctgactctgaaaaggaattatat
attcagcatgctaaagaggacgaaactcgttatcataatgaaatgaagtcttgggaagaa
caaatgattgaagttggacgaaaggatcttctacgtcgcacaataaagaaacaacgaaaa
tatggtgctgaggagtgttaa

DBGET integrated database retrieval system