KEGG   Homo sapiens (human): 7027Help
Entry
7027              CDS       T01001                                 

Gene name
TFDP1, DP1, DRTF1, Dp-1
Definition
transcription factor Dp-1
Orthology
K04683  
transcription factor Dp-1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 410 aa AA seqDB search
MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQ
QVVIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFS
MKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMN
IISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRN
RHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVL
KRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFS
ASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatgccggtctaattgaagccaacggagaactcaaggtcttcatagaccag
aaccttagtcccgggaaaggcgtggtgtccctcgtggccgttcacccctccaccgtcaac
ccgctcgggaagcagctcttgccaaaaacctttggacagtccaatgtcaacattgcccag
caagtggtaattggtacgcctcagagaccggcagcgtcaaacaccctggtggtaggaagc
ccacacacccccagcactcactttgcctctcagaaccagccttccgactcctcaccttgg
tctgccgggaagcgcaacaggaaaggagagaagaatggcaagggcctacggcatttctcc
atgaaggtctgcgagaaggtgcagaggaaagggaccacttcctacaacgaagtggcagac
gagctggttgcggagttcagtgctgccgacaaccacatcttaccaaacgagtcagcttat
gaccagaaaaacataagacggcgcgtctacgatgccttaaacgtgctaatggccatgaac
atcatctccaaggagaagaaggagatcaagtggattggtctgcccaccaactcggctcag
gaatgtcagaacttagaggtggaaagacagaggagacttgaaagaataaaacagaaacag
tctcaacttcaagaacttattctacagcaaattgccttcaagaacctggtgcagagaaac
cggcatgcggagcagcaggccagccggccaccgccacccaactcagtcatccacctgccc
ttcatcatcgtcaacaccagcaagaagacggtcatcgactgcagcatctccaatgacaaa
tttgagtatctgtttaattttgacaacacatttgaaatccacgatgacatagaagtgctg
aagcggatgggcatggcttgcgggctggagtcggggagctgctctgccgaagaccttaaa
atggccagaagtctggtccccaaggctctggagccatacgtgacagaaatggctcaggga
actgttggaggcgtgttcatcacgacggcaggttccacgtctaacggcacaaggttctct
gccagtgacctgaccaacggtgcagatgggatgctggccacaagctccaatgggtctcag
tacagcggctccagggtggagactccggtgtcctacgtcggggaggacgacgaggaggac
gatgacttcaacgagaatgacgaggacgactga

DBGET integrated database retrieval system