KEGG   Homo sapiens (human): 7037Help
Entry
7037              CDS       T01001                                 

Gene name
TFRC, CD71, IMD46, T9, TFR, TFR1, TR, TRFR, p90
Definition
(RefSeq) transferrin receptor
  KO
K06503  
transferrin receptor
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Endocytosis
Phagosome
Ferroptosis
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    7037 (TFRC)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7037 (TFRC)
   04145 Phagosome
    7037 (TFRC)
  Cell growth and death
   04216 Ferroptosis
    7037 (TFRC)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7037 (TFRC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7037 (TFRC)
  Exosomal proteins of colorectal cancer cells
   7037 (TFRC)
CD molecules [BR:hsa04090]
 Proteins
  7037 (TFRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P02786(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q29
AA seq 760 aa AA seqDB search
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAAR
RLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcaagctagatcagcattctctaacttgtttggtggagaaccattgtcatat
acccggttcagcctggctcggcaagtagatggcgataacagtcatgtggagatgaaactt
gctgtagatgaagaagaaaatgctgacaataacacaaaggccaatgtcacaaaaccaaaa
aggtgtagtggaagtatctgctatgggactattgctgtgatcgtctttttcttgattgga
tttatgattggctacttgggctattgtaaaggggtagaaccaaaaactgagtgtgagaga
ctggcaggaaccgagtctccagtgagggaggagccaggagaggacttccctgcagcacgt
cgcttatattgggatgacctgaagagaaagttgtcggagaaactggacagcacagacttc
accggcaccatcaagctgctgaatgaaaattcatatgtccctcgtgaggctggatctcaa
aaagatgaaaatcttgcgttgtatgttgaaaatcaatttcgtgaatttaaactcagcaaa
gtctggcgtgatcaacattttgttaagattcaggtcaaagacagcgctcaaaactcggtg
atcatagttgataagaacggtagacttgtttacctggtggagaatcctgggggttatgtg
gcgtatagtaaggctgcaacagttactggtaaactggtccatgctaattttggtactaaa
aaagattttgaggatttatacactcctgtgaatggatctatagtgattgtcagagcaggg
aaaatcacctttgcagaaaaggttgcaaatgctgaaagcttaaatgcaattggtgtgttg
atatacatggaccagactaaatttcccattgttaacgcagaactttcattctttggacat
gctcatctggggacaggtgacccttacacacctggattcccttccttcaatcacactcag
tttccaccatctcggtcatcaggattgcctaatatacctgtccagacaatctccagagct
gctgcagaaaagctgtttgggaatatggaaggagactgtccctctgactggaaaacagac
tctacatgtaggatggtaacctcagaaagcaagaatgtgaagctcactgtgagcaatgtg
ctgaaagagataaaaattcttaacatctttggagttattaaaggctttgtagaaccagat
cactatgttgtagttggggcccagagagatgcatggggccctggagctgcaaaatccggt
gtaggcacagctctcctattgaaacttgcccagatgttctcagatatggtcttaaaagat
gggtttcagcccagcagaagcattatctttgccagttggagtgctggagactttggatcg
gttggtgccactgaatggctagagggatacctttcgtccctgcatttaaaggctttcact
tatattaatctggataaagcggttcttggtaccagcaacttcaaggtttctgccagccca
ctgttgtatacgcttattgagaaaacaatgcaaaatgtgaagcatccggttactgggcaa
tttctatatcaggacagcaactgggccagcaaagttgagaaactcactttagacaatgct
gctttccctttccttgcatattctggaatcccagcagtttctttctgtttttgcgaggac
acagattatccttatttgggtaccaccatggacacctataaggaactgattgagaggatt
cctgagttgaacaaagtggcacgagcagctgcagaggtcgctggtcagttcgtgattaaa
ctaacccatgatgttgaattgaacctggactatgagaggtacaacagccaactgctttca
tttgtgagggatctgaaccaatacagagcagacataaaggaaatgggcctgagtttacag
tggctgtattctgctcgtggagacttcttccgtgctacttccagactaacaacagatttc
gggaatgctgagaaaacagacagatttgtcatgaagaaactcaatgatcgtgtcatgaga
gtggagtatcacttcctctctccctacgtatctccaaaagagtctcctttccgacatgtc
ttctggggctccggctctcacacgctgccagctttactggagaacttgaaactgcgtaaa
caaaataacggtgcttttaatgaaacgctgttcagaaaccagttggctctagctacttgg
actattcagggagctgcaaatgccctctctggtgacgtttgggacattgacaatgagttt
taa

DBGET integrated database retrieval system