KEGG   Homo sapiens (human): 7037Help
Entry
7037              CDS       T01001                                 

Gene name
TFRC, CD71, T9, TFR, TFR1, TR, TRFR, p90
Definition
transferrin receptor
Orthology
K06503  
transferrin receptor
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Endocytosis
Phagosome
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    7037 (TFRC)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7037 (TFRC)
   04145 Phagosome
    7037 (TFRC)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7037 (TFRC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7037 (TFRC)
  Exosomal proteins of colorectal cancer cells
   7037 (TFRC)
Cellular antigens [BR:hsa04090]
 Proteins
  7037 (TFRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q29
AA seq 760 aa AA seqDB search
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAAR
RLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcaagctagatcagcattctctaacttgtttggtggagaaccattgtcatat
acccggttcagcctggctcggcaagtagatggcgataacagtcatgtggagatgaaactt
gctgtagatgaagaagaaaatgctgacaataacacaaaggccaatgtcacaaaaccaaaa
aggtgtagtggaagtatctgctatgggactattgctgtgatcgtctttttcttgattgga
tttatgattggctacttgggctattgtaaaggggtagaaccaaaaactgagtgtgagaga
ctggcaggaaccgagtctccagtgagggaggagccaggagaggacttccctgcagcacgt
cgcttatattgggatgacctgaagagaaagttgtcggagaaactggacagcacagacttc
accggcaccatcaagctgctgaatgaaaattcatatgtccctcgtgaggctggatctcaa
aaagatgaaaatcttgcgttgtatgttgaaaatcaatttcgtgaatttaaactcagcaaa
gtctggcgtgatcaacattttgttaagattcaggtcaaagacagcgctcaaaactcggtg
atcatagttgataagaacggtagacttgtttacctggtggagaatcctgggggttatgtg
gcgtatagtaaggctgcaacagttactggtaaactggtccatgctaattttggtactaaa
aaagattttgaggatttatacactcctgtgaatggatctatagtgattgtcagagcaggg
aaaatcacctttgcagaaaaggttgcaaatgctgaaagcttaaatgcaattggtgtgttg
atatacatggaccagactaaatttcccattgttaacgcagaactttcattctttggacat
gctcatctggggacaggtgacccttacacacctggattcccttccttcaatcacactcag
tttccaccatctcggtcatcaggattgcctaatatacctgtccagacaatctccagagct
gctgcagaaaagctgtttgggaatatggaaggagactgtccctctgactggaaaacagac
tctacatgtaggatggtaacctcagaaagcaagaatgtgaagctcactgtgagcaatgtg
ctgaaagagataaaaattcttaacatctttggagttattaaaggctttgtagaaccagat
cactatgttgtagttggggcccagagagatgcatggggccctggagctgcaaaatccggt
gtaggcacagctctcctattgaaacttgcccagatgttctcagatatggtcttaaaagat
gggtttcagcccagcagaagcattatctttgccagttggagtgctggagactttggatcg
gttggtgccactgaatggctagagggatacctttcgtccctgcatttaaaggctttcact
tatattaatctggataaagcggttcttggtaccagcaacttcaaggtttctgccagccca
ctgttgtatacgcttattgagaaaacaatgcaaaatgtgaagcatccggttactgggcaa
tttctatatcaggacagcaactgggccagcaaagttgagaaactcactttagacaatgct
gctttccctttccttgcatattctggaatcccagcagtttctttctgtttttgcgaggac
acagattatccttatttgggtaccaccatggacacctataaggaactgattgagaggatt
cctgagttgaacaaagtggcacgagcagctgcagaggtcgctggtcagttcgtgattaaa
ctaacccatgatgttgaattgaacctggactatgagaggtacaacagccaactgctttca
tttgtgagggatctgaaccaatacagagcagacataaaggaaatgggcctgagtttacag
tggctgtattctgctcgtggagacttcttccgtgctacttccagactaacaacagatttc
gggaatgctgagaaaacagacagatttgtcatgaagaaactcaatgatcgtgtcatgaga
gtggagtatcacttcctctctccctacgtatctccaaaagagtctcctttccgacatgtc
ttctggggctccggctctcacacgctgccagctttactggagaacttgaaactgcgtaaa
caaaataacggtgcttttaatgaaacgctgttcagaaaccagttggctctagctacttgg
actattcagggagctgcaaatgccctctctggtgacgtttgggacattgacaatgagttt
taa

DBGET integrated database retrieval system