KEGG   Homo sapiens (human): 7039Help
Entry
7039              CDS       T01001                                 

Gene name
TGFA, TFGA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  
transforming growth factor, alpha
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Pathways in cancer
Renal cell carcinoma
Pancreatic cancer
Glioma
Prostate cancer
Non-small cell lung cancer
Disease
H00018  
Gastric cancer
H00516  
Isolated orofacial clefts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    7039 (TGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7039 (TGFA)
   05212 Pancreatic cancer
    7039 (TGFA)
   05214 Glioma
    7039 (TGFA)
   05211 Renal cell carcinoma
    7039 (TGFA)
   05215 Prostate cancer
    7039 (TGFA)
   05223 Non-small cell lung cancer
    7039 (TGFA)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    7039 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p13
AA seq 160 aa AA seqDB search
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgctctgggtattgtgttggctgcgtgc
caggccttggagaacagcacgtccccgctgagtgcagacccgcccgtggctgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system