KEGG   Homo sapiens (human): 7039Help
Entry
7039              CDS       T01001                                 

Gene name
TGFA, TFGA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  
transforming growth factor, alpha
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
PI3K-Akt signaling pathway
Pathways in cancer
Renal cell carcinoma
Pancreatic cancer
Glioma
Prostate cancer
Non-small cell lung cancer
Hepatocellular carcinoma
Network
N00079  
HIF-1 signaling pathway
N00080  
Loss of VHL to HIF-1 signaling pathway
N00081  
Mutation-inactivated VHL to HIF-1 signaling pathway
N00227  
TGFA-EGFR-PLCG-PKC signaling pathway
N00228  
TGFA-overexpression to PLCG-PKC signaling pathway
N00229  
TGFA-EGFR-RAS-ERK signaling pathway
N00230  
TGFA-overexpression to RAS-ERK signaling pathway
N00231  
TGFA-EGFR-PI3K signaling pathway
N00232  
TGFA-overexpression to PI3K signaling pathway
Disease
H00048  
Hepatocellular carcinoma
H00516  
Cleft lip and/or cleft palate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7039 (TGFA)
   04010 MAPK signaling pathway
    7039 (TGFA)
   04012 ErbB signaling pathway
    7039 (TGFA)
   04151 PI3K-Akt signaling pathway
    7039 (TGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7039 (TGFA)
   05212 Pancreatic cancer
    7039 (TGFA)
   05225 Hepatocellular carcinoma
    7039 (TGFA)
   05214 Glioma
    7039 (TGFA)
   05211 Renal cell carcinoma
    7039 (TGFA)
   05215 Prostate cancer
    7039 (TGFA)
   05223 Non-small cell lung cancer
    7039 (TGFA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    7039 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P01135(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p13.3
AA seq 160 aa AA seqDB search
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgctctgggtattgtgttggctgcgtgc
caggccttggagaacagcacgtccccgctgagtgcagacccgcccgtggctgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system