KEGG   Homo sapiens (human): 7040Help
Entry
7040              CDS       T01001                                 

Gene name
TGFB1, CED, DPD1, LAP, TGFB, TGFbeta
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00680  TGF-beta signaling
Network
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00434  Camurati-Engelmann disease
H01593  Osteoporosis
Drug target
Fresolimumab: D09620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7040 (TGFB1)
   04350 TGF-beta signaling pathway
    7040 (TGFB1)
   04390 Hippo signaling pathway
    7040 (TGFB1)
   04068 FoxO signaling pathway
    7040 (TGFB1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7040 (TGFB1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7040 (TGFB1)
   04218 Cellular senescence
    7040 (TGFB1)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    7040 (TGFB1)
   04672 Intestinal immune network for IgA production
    7040 (TGFB1)
  Endocrine system
   04926 Relaxin signaling pathway
    7040 (TGFB1)
  Development
   04380 Osteoclast differentiation
    7040 (TGFB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7040 (TGFB1)
   05205 Proteoglycans in cancer
    7040 (TGFB1)
   05210 Colorectal cancer
    7040 (TGFB1)
   05212 Pancreatic cancer
    7040 (TGFB1)
   05225 Hepatocellular carcinoma
    7040 (TGFB1)
   05226 Gastric cancer
    7040 (TGFB1)
   05220 Chronic myeloid leukemia
    7040 (TGFB1)
   05211 Renal cell carcinoma
    7040 (TGFB1)
  Immune diseases
   05323 Rheumatoid arthritis
    7040 (TGFB1)
   05321 Inflammatiory bowel disease (IBD)
    7040 (TGFB1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7040 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    7040 (TGFB1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7040 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    7040 (TGFB1)
  Infectious diseases
   05152 Tuberculosis
    7040 (TGFB1)
   05166 HTLV-I infection
    7040 (TGFB1)
   05161 Hepatitis B
    7040 (TGFB1)
   05146 Amoebiasis
    7040 (TGFB1)
   05144 Malaria
    7040 (TGFB1)
   05145 Toxoplasmosis
    7040 (TGFB1)
   05140 Leishmaniasis
    7040 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    7040 (TGFB1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   7040 (TGFB1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7040 (TGFB1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   7040 (TGFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta Sterile
Motif
Other DBs
NCBI-GeneID: 7040
NCBI-ProteinID: NP_000651
OMIM: 190180
HGNC: 11766
Ensembl: ENSG00000105329
Vega: OTTHUMG00000182760
Pharos: P01137(Tchem)
UniProt: P01137
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 390 aa AA seqDB search
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgtggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system