KEGG   Homo sapiens (human): 7042Help
Entry
7042              CDS       T01001                                 

Gene name
TGFB2, G-TSF, LDS4, TGF-beta2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  
transforming growth factor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Module
TGF-beta signaling
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H00800  
Loeys-Dietz syndrome (LDS)
Drug target
Fresolimumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7042 (TGFB2)
   04350 TGF-beta signaling pathway
    7042 (TGFB2)
   04390 Hippo signaling pathway
    7042 (TGFB2)
   04068 FoxO signaling pathway
    7042 (TGFB2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7042 (TGFB2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7042 (TGFB2)
  Cell growth and death
   04110 Cell cycle
    7042 (TGFB2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    7042 (TGFB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7042 (TGFB2)
   05206 MicroRNAs in cancer
    7042 (TGFB2)
   05205 Proteoglycans in cancer
    7042 (TGFB2)
   05210 Colorectal cancer
    7042 (TGFB2)
   05212 Pancreatic cancer
    7042 (TGFB2)
   05220 Chronic myeloid leukemia
    7042 (TGFB2)
   05211 Renal cell carcinoma
    7042 (TGFB2)
  Immune diseases
   05323 Rheumatoid arthritis
    7042 (TGFB2)
   05321 Inflammatiory bowel disease (IBD)
    7042 (TGFB2)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7042 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    7042 (TGFB2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7042 (TGFB2)
  Infectious diseases
   05152 Tuberculosis
    7042 (TGFB2)
   05166 HTLV-I infection
    7042 (TGFB2)
   05161 Hepatitis B
    7042 (TGFB2)
   05146 Amoebiasis
    7042 (TGFB2)
   05144 Malaria
    7042 (TGFB2)
   05145 Toxoplasmosis
    7042 (TGFB2)
   05140 Leishmaniasis
    7042 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    7042 (TGFB2)
Cytokines [BR:hsa04052]
 TGF-beta family
  TGF-beta subfamily
   7042 (TGFB2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-8
    ITGB1; integrin beta 1 [KO:K05719]
     7042 (TGFB2)
   alpha V beta 1
     7042 (TGFB2)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     7042 (TGFB2)
  Beta6 integrins
   alpha V beta 6
    ITGB6; integrin beta 6 [KO:K06589]
     7042 (TGFB2)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     7042 (TGFB2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   7042 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41
AA seq 414 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaattgttcgatttgacgtctcagcaatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgaacaacggattgagctatatcagattctcaagtccaaagatttaacatctcca
acccagcgctacatcgacagcaaagttgtgaaaacaagagcagaaggcgaatggctctcc
ttcgatgtaactgatgctgttcatgaatggcttcaccataaagacaggaacctgggattt
aaaataagcttacactgtccctgctgcacttttgtaccatctaataattacatcatccca
aataaaagtgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttattgccctcctacagacttgagtcacaacagaccaaccggcggaag
aagcgtgctttggatgcggcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatctagggtggaaatggatacacgaacccaaaggg
tacaatgccaacttctgtgctggagcatgcccgtatttatggagttcagacactcagcac
agcagggtcctgagcttatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaagatttagaacctctaaccattctctactacattggcaaaacacccaagatt
gaacagctttctaatatgattgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system