KEGG   Homo sapiens (human): 7046Help
Entry
7046              CDS       T01001                                 

Gene name
TGFBR1, AAT5, ACVRLK4, ALK-5, ALK5, ESS1, LDS1, LDS1A, LDS2A, MSSE, SKR4, TGFR-1, tbetaR-I
Definition
(RefSeq) transforming growth factor beta receptor I (EC:2.7.11.30)
  KO
K04674  
TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
Hepatitis B
HTLV-I infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Module
TGF-beta signaling
Disease
H00800  
Loeys-Dietz syndrome (LDS)
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7046 (TGFBR1)
   04350 TGF-beta signaling pathway
    7046 (TGFBR1)
   04390 Hippo signaling pathway
    7046 (TGFBR1)
   04068 FoxO signaling pathway
    7046 (TGFBR1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7046 (TGFBR1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7046 (TGFBR1)
  Cellular commiunity
   04520 Adherens junction
    7046 (TGFBR1)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    7046 (TGFBR1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7046 (TGFBR1)
   05210 Colorectal cancer
    7046 (TGFBR1)
   05212 Pancreatic cancer
    7046 (TGFBR1)
   05220 Chronic myeloid leukemia
    7046 (TGFBR1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7046 (TGFBR1)
  Infectious diseases
   05166 HTLV-I infection
    7046 (TGFBR1)
   05161 Hepatitis B
    7046 (TGFBR1)
   05142 Chagas disease (American trypanosomiasis)
    7046 (TGFBR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     7046 (TGFBR1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR1 family [OT]
   7046 (TGFBR1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type I TGF-beta receptor
   7046 (TGFBR1)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   7046 (TGFBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22
AA seq 503 aa AA seqDB search
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggtcgctgctccgcgtccccggctgctcctcctcgtgctggcggcggcg
gcggcggcggcggcggcgctgctcccgggggcgacggcgttacagtgtttctgccacctc
tgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtcacagag
accacagacaaagttatacacaacagcatgtgtatagctgaaattgacttaattcctcga
gataggccgtttgtatgtgcaccctcttcaaaaactgggtctgtgactacaacatattgc
tgcaatcaggaccattgcaataaaatagaacttccaactactgtaaagtcatcacctggc
cttggtcctgtggaactggcagctgtcattgctggaccagtgtgcttcgtctgcatctca
ctcatgttgatggtctatatctgccacaaccgcactgtcattcaccatcgagtgccaaat
gaagaggacccttcattagatcgcccttttatttcagagggtactacgttgaaagactta
atttatgatatgacaacgtcaggttctggctcaggtttaccattgcttgttcagagaaca
attgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttggagaagtttgg
agaggaaagtggcggggagaagaagttgctgttaagatattctcctctagagaagaacgt
tcgtggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaaaacatcctg
ggatttatagcagcagacaataaagacaatggtacttggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattacttaaacagatacacagttactgtggaa
ggaatgataaaacttgctctgtccacggcgagcggtcttgcccatcttcacatggagatt
gttggtacccaaggaaagccagccattgctcatagagatttgaaatcaaagaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaagacatgattca
gccacagataccattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaacgtgctgac
atctatgcaatgggcttagtattctgggaaattgctcgacgatgttccattggtggaatt
catgaagattaccaactgccttattatgatcttgtaccttctgacccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatatcccaaacagatggcagagc
tgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaatggagca
gctaggcttacagcattgcggattaagaaaacattatcgcaactcagtcaacaggaaggc
atcaaaatgtaa

DBGET integrated database retrieval system