KEGG   Homo sapiens (human): 7046Help
Entry
7046              CDS       T01001                                 

Gene name
TGFBR1, AAT5, ACVRLK4, ALK-5, ALK5, LDS1A, LDS2A, MSSE, SKR4, TGFR-1, ESS1
Definition
transforming growth factor, beta receptor 1 (EC:2.7.11.30)
Orthology
K04674  
TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
Hepatitis B
HTLV-I infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Disease
H00800  
Loeys-Dietz syndrome (LDS)
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22
AA seq 426 aa AA seqDB search
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLV
QRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHE
NILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLH
MEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKR
YMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPS
VEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQ
QEGIKM
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggtcgctgctccgcgtccccggctgctcctcctcgtgctggcggcggcg
gcggcggcggcggcggcgctgctcccgggggcgacggcgttacagtgtttctgccacctc
tgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtcacagag
accacagacaaagttatacacaacagcatgtgtatagctgaaattgacttaattcctcga
gataggccgtttgtatgtgcaccctcttcaaaaactgggtctgtgactacaacatattgc
tgcaatcaggaccattgcaataaaatagaacttccaactactggtttaccattgcttgtt
cagagaacaattgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttgga
gaagtttggagaggaaagtggcggggagaagaagttgctgttaagatattctcctctaga
gaagaacgttcgtggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaa
aacatcctgggatttatagcagcagacaataaagacaatggtacttggactcagctctgg
ttggtgtcagattatcatgagcatggatccctttttgattacttaaacagatacacagtt
actgtggaaggaatgataaaacttgctctgtccacggcgagcggtcttgcccatcttcac
atggagattgttggtacccaaggaaagccagccattgctcatagagatttgaaatcaaag
aatatcttggtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaaga
catgattcagccacagataccattgatattgctccaaaccacagagtgggaacaaaaagg
tacatggcccctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaa
cgtgctgacatctatgcaatgggcttagtattctgggaaattgctcgacgatgttccatt
ggtggaattcatgaagattaccaactgccttattatgatcttgtaccttctgacccatca
gttgaagaaatgagaaaagttgtttgtgaacagaagttaaggccaaatatcccaaacaga
tggcagagctgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgcc
aatggagcagctaggcttacagcattgcggattaagaaaacattatcgcaactcagtcaa
caggaaggcatcaaaatgtaa

DBGET integrated database retrieval system