KEGG   Homo sapiens (human): 7052Help
Entry
7052              CDS       T01001                                 

Gene name
TGM2, G-ALPHA-h, GNAH, HEL-S-45, TG2, TGC
Definition
transglutaminase 2 (EC:2.3.2.13)
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Class
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q12
AA seq 687 aa AA seqDB search
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagctggtcttagagaggtgtgatctggagctggagaccaatggccgagac
caccacacggccgacctgtgccgggagaagctggtggtgcgacggggccagcccttctgg
ctgaccctgcactttgagggccgcaactacgaggccagtgtagacagtctcaccttcagt
gtcgtgaccggcccagcccctagccaggaggccgggaccaaggcccgttttccactaaga
gatgctgtggaggagggtgactggacagccaccgtggtggaccagcaagactgcaccctc
tcgctgcagctcaccaccccggccaacgcccccatcggcctgtatcgcctcagcctggag
gcctccactggctaccagggatccagctttgtgctgggccacttcattttgctcttcaac
gcctggtgcccagcggatgctgtgtacctggactcggaagaggagcggcaggagtatgtc
ctcacccagcagggctttatctaccagggctcggccaagttcatcaagaacataccttgg
aattttgggcagtttgaagatgggatcctagacatctgcctgatccttctagatgtcaac
cccaagttcctgaagaacgccggccgtgactgctcccgccgcagcagccccgtctacgtg
ggccgggtggtgagtggcatggtcaactgcaacgatgaccagggtgtgctgctgggacgc
tgggacaacaactacggggacggcgtcagccccatgtcctggatcggcagcgtggacatc
ctgcggcgctggaagaaccacggctgccagcgcgtcaagtatggccagtgctgggtcttc
gccgccgtggcctgcacagtgctgaggtgcctgggcatccctacccgcgtcgtgaccaac
tacaactcggcccatgaccagaacagcaaccttctcatcgagtacttccgcaatgagttt
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccggacctgcagccggggtacgagggctggcaggccctggacccaacg
ccccaggagaagagcgaagggacgtactgctgtggcccagttccagttcgtgccatcaag
gagggcgacctgagcaccaagtacgatgcgccctttgtctttgcggaggtcaatgccgac
gtggtagactggatccagcaggacgatgggtctgtgcacaaatccatcaaccgttccctg
atcgttgggctgaagatcagcactaagagcgtgggccgagacgagcgggaggatatcacc
cacacctacaaatacccagaggggtcctcagaggagagggaggccttcacaagggcgaac
cacctgaacaaactggccgagaaggaggagacagggatggccatgcggatccgtgtgggc
cagagcatgaacatgggcagtgactttgacgtctttgcccacatcaccaacaacaccgct
gaggagtacgtctgccgcctcctgctctgtgcccgcaccgtcagctacaatgggatcttg
gggcccgagtgtggcaccaagtacctgctcaacctcaacctggagcctttctctgagaag
agcgttcctctttgcatcctctatgagaaataccgtgactgccttacggagtccaacctc
atcaaggtgcgggccctcctcgtggagccagttatcaacagctacctgctggctgagagg
gacctctacctggagaatccagaaatcaagatccggatccttggggagcccaagcagaaa
cgcaagctggtggctgaggtgtccctgcagaacccgctccctgtggccctggaaggctgc
accttcactgtggagggggccggcctgactgaggagcagaagacggtggagatcccagac
cccgtggaggcaggggaggaagttaaggtgagaatggacctgctgccgctccacatgggc
ctccacaagctggtggtgaacttcgagagcgacaagctgaaggctgtgaagggcttccgg
aatgtcatcattggccccgcctaa

DBGET integrated database retrieval system