KEGG   Homo sapiens (human): 7057Help
Entry
7057              CDS       T01001                                 

Gene name
THBS1, THBS, THBS-1, TSP, TSP-1, TSP1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q15
AA seq 1170 aa AA seqDB search
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactaggcgtcctgttcctgatgcatgtgtgtggcaccaaccgc
attccagagtctggcggagacaacagcgtgtttgacatctttgaactcaccggggccgcc
cgcaaggggtctgggcgccgactggtgaagggccccgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gctgtgcgggcagaaaagggtttcctccttctggcatccctgaggcagatgaagaagacc
cggggcacgctgctggccctggagcggaaagaccactctggccaggtcttcagcgtggtg
tccaatggcaaggcgggcaccctggacctcagcctgaccgtccaaggaaagcagcacgtg
gtgtctgtggaagaagctctcctggcaaccggccagtggaagagcatcaccctgtttgtg
caggaagacagggcccagctgtacatcgactgtgaaaagatggagaatgctgagttggac
gtccccatccaaagcgtcttcaccagagacctggccagcatcgccagactccgcatcgca
aaggggggcgtcaatgacaatttccagggggtgctgcagaatgtgaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtcctcctc
acccttgacaacaacgtggtgaatggttccagccctgccatccgcactaactacattggc
cacaagacaaaggacttgcaagccatctgcggcatctcctgtgatgagctgtccagcatg
gtcctggaactcaggggcctgcgcaccattgtgaccacgctgcaggacagcatccgcaaa
gtgactgaagagaacaaagagttggccaatgagctgaggcggcctcccctatgctatcac
aacggagttcagtacagaaataacgaggaatggactgttgatagctgcactgagtgtcac
tgtcagaactcagttaccatctgcaaaaaggtgtcctgccccatcatgccctgctccaat
gccacagttcctgatggagaatgctgtcctcgctgttggcccagcgactctgcggacgat
ggctggtctccatggtccgagtggacctcctgttctacgagctgtggcaatggaattcag
cagcgcggccgctcctgcgatagcctcaacaaccgatgtgagggctcctcggtccagaca
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggtggctggagccac
tggtccccgtggtcatcttgttctgtgacatgtggtgatggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaacgggaaaccctgtgaaggcgaagcgcgggag
accaaagcctgcaagaaagacgcctgccccatcaatggaggctggggtccttggtcacca
tgggacatctgttctgtcacctgtggaggaggggtacagaaacgtagtcgtctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgtaacagaaaaccagatc
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgccggcgtg
aagtgtactagctaccctgatggcagctggaaatgtggtgcttgtccccctggttacagt
ggaaatggcatccagtgcacagatgttgatgagtgcaaagaagtgcctgatgcctgcttc
aaccacaatggagagcaccggtgtgagaacacggaccccggctacaactgcctgccctgc
cccccacgcttcaccggctcacagcccttcggccagggtgtcgaacatgccacggccaac
aaacaggtgtgcaagccccgtaacccctgcacggatgggacccacgactgcaacaagaac
gccaagtgcaactacctgggccactatagcgaccccatgtaccgctgcgagtgcaagcct
ggctacgctggcaatggcatcatctgcggggaggacacagacctggatggctggcccaat
gagaacctggtgtgcgtggccaatgcgacttaccactgcaaaaaggataattgccccaac
cttcccaactcagggcaggaagactatgacaaggatggaattggtgatgcctgtgatgat
gacgatgacaatgataaaattccagatgacagggacaactgtccattccattacaaccca
gctcagtatgactatgacagagatgatgtgggagaccgctgtgacaactgtccctacaac
cacaacccagatcaggcagacacagacaacaatggggaaggagacgcctgtgctgcagac
attgatggagacggtatcctcaatgaacgggacaactgccagtacgtctacaatgtggac
cagagagacactgatatggatggggttggagatcagtgtgacaattgccccttggaacac
aatccggatcagctggactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaatctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccacgatgatgacaac
gatggcattcctgatgacaaggacaactgcagactcgtgcccaatcccgaccagaaggac
tctgacggcgatggtcgaggtgatgcctgcaaagatgattttgaccatgacagtgtgcca
gacatcgatgacatctgtcctgagaatgttgacatcagtgagaccgatttccgccgattc
cagatgattcctctggaccccaaagggacatcccaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggactcgctgtaggttat
gatgagtttaatgctgtggacttcagtggcaccttcttcatcaacaccgaaagggacgat
gactatgctggatttgtctttggctaccagtccagcagccgcttttatgttgtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccacgagggctcagggatactcgggc
ctttctgtgaaagttgtaaactccaccacagggcctggcgagcacctgcggaacgccctg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgtcacata
ggctggaaagatttcaccgcctacagatggcgtctcagccacaggccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctatgat
aaaacctatgctggtggtagactagggttgtttgtcttctctcaagaaatggtgttcttc
tctgacctgaaatacgaatgtagagatccctaa

DBGET integrated database retrieval system