KEGG   Homo sapiens (human): 7082Help
Entry
7082              CDS       T01001                                 

Gene name
TJP1, ZO-1
Definition
(RefSeq) tight junction protein 1
  KO
K05701  
tight junction protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Tight junction
Gap junction
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    7082 (TJP1)
   04530 Tight junction
    7082 (TJP1)
   04540 Gap junction
    7082 (TJP1)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    7082 (TJP1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    7082 (TJP1)
   05132 Salmonella infection
    7082 (TJP1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     7082 (TJP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q07157(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
15q13.1
AA seq 1748 aa AA seqDB search
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
PEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHAD
DHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPT
PAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLK
QPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESSSYTDQFSRNYEHRLRY
EDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPLSY
DSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQYFEQYSRSYE
QVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK
PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHD
KTLYRIPEPQKPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHL
SEPAKPAHSQNQSNFSSYSSKGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQ
PVTSASLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYP
QKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHK
PDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSA
VEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS
ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANC
VSVLIDHF
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagagctgcggccgccaagagcacagcaatggaggaaacagctatatgggaa
caacatacagtgacgcttcacagggctcctggatttggatttggaattgcaatatctggt
ggacgagataatcctcattttcagagtggggaaacgtcaatagtgatttcagatgtgctg
aaaggaggaccagctgaaggacagctacaggaaaatgaccgagttgcaatggttaacgga
gtttcaatggataatgttgaacatgcttttgctgttcagcaactaaggaaaagtgggaaa
aatgcaaaaattacaattagaaggaagaagaaagttcaaataccagtaagtcgtcctgat
cctgaaccagtatctgataatgaagaagatagttatgatgaggaaatacatgatccaaga
agtggccggagtggtgtggttaacagaaggagtgagaagatttggccgagggatagaagt
gcaagtagagagaggagcttgtccccgcggtcagacaggcggtcagtggcttccagccag
cctgctaaacctactaaagtcacactggtgaaatcccggaaaaatgaagaatatggtctt
cgattggcaagccatatatttgttaaggaaatttcacaagatagtttggcagcaagagat
ggcaatattcaagaaggtgatgttgtattgaagataaatggtactgtgacagaaaatatg
tcattgacagatgcaaagacattgatagaaaggtctaaaggcaaattaaaaatggtagtt
caaagagatgaacgggctacgctattgaatgtccctgatctttctgacagcatccactct
gctaatgcctctgagagagacgacatttcagaaattcagtcactggcatcagatcattct
ggtcgatcacacgataggcctccccgccgcagccggtcacgatctcctgaccagcggtca
gagccttctgatcattccaggcactcgccgcagcagccaagcaatggcagtctccggagt
agagatgaagagagaatttctaaacctggggctgtctcaactcctgtaaagcatgctgat
gatcacacacctaaaacagtggaagaagttacagttgaaagaaatgagaaacaaacacct
tctcttccagaaccaaagcctgtgtatgcccaagttgggcaaccagatgtggatttacct
gtcagtccatctgatggtgtcctacctaattcaactcatgaagatgggattcttcggccc
agcatgaaattggtaaaattcagaaaaggagatagtgtgggtttgcggctggctggtgga
aatgatgttggaatatttgtagctggcgttctagaagatagccctgcagccaaggaaggc
ttagaggaaggtgatcaaattctcagggtaaacaacgtagattttacaaatatcataaga
gaagaagccgtccttttcctgcttgacctccctaaaggagaagaagtgaccatattggct
cagaagaagaaggatgtttatcgtcgcattgtagaatcagatgtaggagattctttctat
attagaacccattttgaatatgaaaaggaatctccctatggacttagttttaacaaagga
gaggtgttccgtgttgtggataccttgtacaatggaaaactgggctcttggcttgctatt
cgaattggtaaaaatcataaggaggtagaacgaggcatcatccctaataagaacagagct
gagcagctagccagtgtacagtatacacttccaaaaacagcaggcggagaccgtgctgac
ttctggagattcagaggtcttcgcagctccaagagaaatcttcgaaaaagcagagaggat
ttgtccgctcagcctgttcaaacaaagtttccagcttatgaaagagtggttcttcgagaa
gctggatttctgaggcctgtaaccatttttggaccaatagctgatgttgccagagaaaag
ctggcaagagaagaaccagatatttatcaaattgcaaagagtgaaccacgagacgctgga
actgaccaacgtagctctggcattattcgcctgcatacaataaagcaaatcatagatcaa
gacaaacatgctttattagatgtaacaccaaatgcagttgatcgtcttaactatgcccag
tggtatccaattgttgtatttcttaaccctgattctaagcaaggagtaaaaacaatgaga
atgaggttatgtccagaatctcggaaaagtgccaggaagttatacgagcgatctcataaa
cttcgtaaaaataatcaccatctttttacaactacaattaacttaaattcaatgaatgat
ggttggtatggtgcgctgaaagaagcaattcaacaacagcaaaaccagctggtatgggtt
tccgagggaaaggcggatggtgctacaagtgatgaccttgatttgcatgatgatcgtctg
tcctacctgtcagctccaggtagtgaatactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagacacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggttgggactccaccggagtctgccattacacggtcctctgagcct
gtaagagaggactcctctggaatgcatcatgaaaaccaaacatatcctccttactcacca
caagcgcagccacaaccaattcatagaatagactcccctggatttaagccagcctctcaa
cagaaagcagaagcttcatctccagtcccttacctttcgcctgaaacaaacccagcatca
tcaacctctgctgttaatcataatgtaaatttaactaatgtcagactggaggagcccacc
ccagctccttccacctcttactcaccacaagctgattctttaagaacaccaagtactgag
gcagctcacataatgctaagagatcaagaaccatcattgtcgtcgcatgtagatccaaca
aaggtgtatagaaaggatccatatcccgaggaaatgatgaggcagaaccatgttttgaaa
cagccagccgttagtcacccagggcacaggccagacaaagagcctaatctgacctatgaa
ccccaactcccatacgtagagaaacaagccagcagagacctcgagcagcccacatacaga
tacgagtcctcaagctatacggaccagttttctcgaaactatgaacatcgtctgcgatac
gaagatcgcgtccccatgtatgaagaacagtggtcatattatgatgacaaacagccctac
ccatctcggccaccttttgataatcagcactctcaagaccttgactccagacagcatccc
gaagagtcctcagaacgagggtactttccacgttttgaagagccagcccctctgtcttac
gacagcagaccacgttacgaacaggcacctagagcatccgccctgcggcacgaagagcag
ccagctcctgggtatgacacacatggtagactcagaccggaagcccagccccacccttca
gcagggcccaagcctgcagagtccaagcagtattttgagcaatattcacgcagttacgag
caagtaccaccccaaggatttacctctagagcaggtcattttgagcctctccatggtgct
gcagctgtccctccgctgataccttcatctcagcataagccagaagctctgccttcaaac
accaaaccactgcctccacccccaactcaaaccgaagaagaggaagatccagcaatgaag
ccacagtctgtactcaccagagttaagatgtttgaaaacaaaagatctgcatccttagag
accaagaaggatgtaaatgacactggcagttttaagcctccagaagtagcatctaaacct
tcaggtgctcccatcattggtcccaaacccacttctcagaatcaattcagtgaacatgac
aaaactctgtacaggatcccagaacctcaaaaacctcaactgaagccacctgaagatatt
gttcggtccaatcattatgaccctgaagaagatgaagaatattatcgaaaacagctgtca
tactttgaccgaagaagttttgagaataagcctcctgcacacattgccgccagccatctc
tccgagcctgcaaagccagcgcattctcagaatcaatcaaatttttctagttattcttca
aagggaaagcctcctgaagctgatggtgtggatagatcatttggcgagaaacgctatgaa
cccatccaggccactccccctcctcctccattgccctcgcagtatgcccagccatctcag
cctgtcaccagcgcgtctctccacatacattctaagggagcacatggtgaaggtaattca
gtgtcattggattttcagaattccttagtgtccaaaccagacccacctccatctcagaat
aagccagcaactttcagaccaccaaaccgagaagatactgctcaggcagctttctatccc
cagaaaagttttccagataaagccccagttaatggaactgaacagactcagaaaacagtc
actccagcatacaatcgattcacaccaaaaccatatacaagttctgcccgaccatttgaa
cgcaagtttgaaagtcctaaattcaatcacaatcttctgccaagtgaaactgcacataaa
cctgacttgtcttcaaaaactcccacttctccaaaaactcttgtgaaatcgcacagtttg
gcacagcctcctgagtttgacagtggagttgaaactttctctatccatgcagagaagcct
aaatatcaaataaataatatcagcacagtgcctaaagctattcctgtgagtccttcagct
gtggaagaggatgaagatgaagatggtcatactgtggtggccacagcccgaggcatattt
aacagcaatgggggcgtgctgagttccatagaaactggtgttagtataattatccctcaa
ggagccattcccgaaggagttgagcaggaaatctatttcaaggtctgccgggacaacagc
atccttccacctttagataaagagaaaggtgaaacactgctgagtcctttggtgatgtgt
ggtccccatggcctcaagttcctgaagcctgtggagctgcgcttaccacactgtgatcct
aaaacctggcaaaacaagtgtcttcccggagatccaaattatctcgttggagcaaactgt
gtttctgtccttattgaccacttttaa

DBGET integrated database retrieval system