KEGG   Homo sapiens (human): 7094Help
Entry
7094              CDS       T01001                                 

Gene name
TLN1, ILWEQ, TLN
Definition
talin 1
Orthology
K06271  
talin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    7094 (TLN1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7094 (TLN1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    7094 (TLN1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    7094 (TLN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7094 (TLN1)
  Exosomal proteins of other cancer cells
   7094 (TLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13
AA seq 2541 aa AA seqDB search
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt NT seq  +upstreamnt  +downstreamnt
atggttgcactttcactgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggcccca
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaagggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaatcatgatgaatattcattggttcgagagctgatggaagagaaaaaggaggaa
ataacagggaccttaagaaaggacaagacattgctgcgagatgaaaagaagatggagaaa
ctaaagcagaaattgcacacagatgatgagttgaactggctggaccatggtcggacactg
agggagcagggtgtagaggagcacgagacgctgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccctgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaagcacaaggctggcttcctt
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcagatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
gggaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaagaccaaggaagtgatccaggagtggaacctcaccaacatcaaacgctgggct
gcgtctcccaaaagcttcaccctggattttggagattaccaagatggctattactcagta
cagacaactgaaggggagcagattgcacagctcattgccggctacatcgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcaatacaaccgggtgggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtcct
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcagcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgccg
cctcttggccaggatgctgcctctaaggcctggcgtaaaaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcgtctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggagatgtcccgtggggtgaagctgctggctgccttgctggaggac
gaaggcggcagtggtcggcccctgttgcaggcagcaaagggccttgcgggagcagtgtca
gaactgctgcgcagtgcccaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccaggatgcgctaatgcagctcgccaaagctgtggcaagtgctgcagct
gccctggtcctcaaggccaagagtgtggcccagcggacagaggactcgggacttcagacc
caagttattgctgcagcaacacagtgtgccctatccacttcccaactagtggcctgtact
aaggtggtggcacctacaatcagctcacctgtctgccaagagcaactggtggaggctgga
cgactggtagccaaagccgtggagggctgtgtgtctgcctcccaggcagctacagaggat
gggcaactgttgcgaggggtaggagcagcagccacagctgtcacccaggccctaaatgag
ctgctgcagcatgtgaaagcccatgccacaggggctgggcctgctggccgttatgaccag
gctactgacaccatcctaaccgtcactgagaacatctttagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacatctgacctggtcaatgccatc
aaggctgatgctgagggggaaagtgatctggagaactcccgcaagctcttaagtgctgcc
aagatcctagctgatgccacagccaagatggtagaggctgccaagggagcagctgcccac
cctgacagtgaggagcagcagcagcggctgcgggaggcagctgaggggctgcgcatggcc
accaatgcagctgcgcagaatgccatcaagaaaaagctggtgcagcgcctggagcatgca
gccaagcaggctgcagcctcagccacacagaccatcgctgcagctcagcacgcagcctct
acccccaaggcctctgccggcccccagcccctgctggtgcagagctgcaaggcagtggca
gagcagattccactgctggtgcagggcgtccgaggaagccaagcccagcctgacagcccc
agcgctcagcttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagctgcaaaggcctcagtgccaacgattcaggaccaggcttcagccatgcagctg
agtcagtgtgccaagaacctgggcaccgcgctggctgaactccggacggctgcccagaag
gctcaggaagcatgtggacctttggagatggattctgcactgagtgtggtacagaatcta
gagaaagatctacaggaagtgaaggcagcagctcgagatggcaagcttaaacccttacct
ggggagacaatggagaagtgtacccaggacctgggcaacagcaccaaagccgtgagctca
gccatcgcccagctactgggagaggttgcccagggcaatgagaattatgcaggtattgca
gctcgggatgtggcaggtgggctgcggtcactggcccaggccgctaggggagtcgctgca
ctgacgtcagatcctgcagtgcaggccattgtacttgatacggccagtgatgtgctggac
aaggccagcagcctcattgaggaggcgaaaaaggcagctggccatccaggggaccctgag
agccagcagcggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtc
agctgcctacctggccagcgcgatgtggataatgccctgagggcagttggagatgccagc
aagcgactcctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagc
cggttgaatgaagctgctgctgggctgaatcaggcagccacagaactggtgcaggcctct
cggggaacccctcaggacctggctcgagcctcaggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggcaggccaggctccgagccaggaggaccgagcccaa
gttgtgtccaacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaag
gccctgtccacggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagg
gcagtaactgacagcatcaatcagctcatcactatgtgcacccagcaggcacccggccag
aaggagtgtgataacgccctgcgggaattggagacggtccgggaactcctggagaaccca
gtccagcccatcaatgacatgtcctactttggttgcctggacagtgtaatggagaactca
aaggtgctgggcgaggccatgactggcatctcccaaaatgccaagaacggaaacctgcca
gagtttggagatgccatttccacagcctcaaaggcactttgtggcttcaccgaggcagct
gcacaggctgcatatctggttggtgtctctgaccccaatagccaagctggacagcaaggg
ctagtggagcccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccagagt
ttgggagagcctggctgtacccaggcccaggtgctctctgcagccaccattgtggctaaa
cacacctctgcactgtgtaacagctgtcgcctggcttctgcccgtaccaccaatcctact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagcacagctaatcttgtc
aagaccatcaaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagca
gcaacagcccctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgag
ttctccagcattcctgcccagatcagccctgagggtcgggctgccatggagcccattgtg
atctctgccaagacaatgttagagagtgccgggggactcatccagacagcccgggccctc
gcagtcaatccccgggaccccccgagctggtcggtgctggccggccactcccgtactgtc
tcagactccatcaagaagctaattacaagcatgagggacaaggctccagggcagctggag
tgtgaaacggccattgcagctctgaacagttgtctacgggacctagaccaggcttccctc
gctgcagtcagccagcagcttgctccccgtgagggaatctctcaagaggccttgcacact
cagatgctcactgcagtccaagagatctcccatctcattgagccgctggccaatgctgcc
cgggctgaagcctcccagctgggacacaaggtgtcccagatggcgcagtactttgagccg
ctcaccctggctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggca
ctcctggaccagactaaaacattggcagagtctgccctgcagttgctatacactgccaag
gaggctggtggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtg
cagatgatgaccgaggccgtagaggacctgacaacaaccctcaacgaggcagccagtgct
gctggggtcgtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaa
ggaccaatgggtgaaccagaaggttccttcgtggattaccaaacaactatggtgcggaca
gccaaggccattgcagtgaccgttcaggagatggttaccaagtcaaacaccagcccagag
gagctgggccctcttgctaaccagctgaccagtgactatggccgtctggcctcggaggcc
aagcctgcagcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggta
caggagctgggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagc
cccagtgatgcctacaccaagaaggagctcatagagtgtgcccggagagtctctgagaag
gtctcccacgtcctggctgcgctccaggctgggaatcgtggcacccaggcctgcatcaca
gcagccagcgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgccact
gctggcacgctcaatcgtgagggtactgaaactttcgctgaccaccgggagggcatcctg
aagactgcgaaggtgctggtggaggacaccaaggtcctggtgcaaaacgcagctgggagc
caggagaagttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcgctgat
gtggtcaagctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtacta
atcaacgcagtgaaagatgtagccaaagccctgggagacctcatcagtgcaacgaaggct
gcagctggcaaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggtg
atggtgaccaatgtgacatcattgcttaagacagtaaaagccgtggaagatgaggccacc
aaaggcactcgggccctggaggcaaccacagaacacatacggcaggagctggcggttttc
tgttccccagagccacctgccaagacctctaccccagaagacttcatccgaatgaccaag
ggtatcaccatggcaaccgccaaggccgttgctgctggcaattcctgtcgccaggaagat
gtcattgccacagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaag
gaagcagcttaccacccagaagtggcccctgatgtgcggcttcgagccctgcactatggc
cgggagtgtgccaatggctacctggaactgctggaccatgtactgctgaccctgcagaag
ccaagcccagaactgaagcagcagttgacaggacattcaaagcgtgtggctggttccgtc
actgagctcatccaggctgctgaagccatgaagggaacagaatgggtagacccagaggac
cccacagtcattgctgagaatgagctcctgggagctgcagccgccattgaggctgcagcc
aaaaagctagagcagctgaagccccgggccaaacccaaggaggcagatgagtccttgaac
tttgaggagcagatactagaagctgccaagtccattgcagcagccaccagtgcactggta
aaggctgcgtcggctgcccagagagaactagtggcccaagggaaggtgggtgccattcca
gccaatgcactggacgatgggcagtggtcccagggcctcatttctgctgcccggatggtg
gctgcggccaccaacaatctgtgtgaggcagccaatgcagctgtacaaggccatgccagc
caggagaagctcatctcatcagccaagcaggtagctgcctccacagcccagctccttgtg
gcctgcaaggtcaaggctgaccaggactcggaggcaatgaaacgacttcaggctgctggc
aacgcagtgaagcgagcctcagataatctggtgaaagcagcacagaaggctgcagccttt
gaagagcaggagaatgagacagtggtggtgaaagagaagatggttggcggcattgcccag
atcatcgcagcacaggaagaaatgcttcggaaggaacgagagctggaagaggcgcggaag
aaactggcccagatccggcagcagcagtacaagtttctgccttcagagcttcgagatgag
cactaa

DBGET integrated database retrieval system