KEGG   Homo sapiens (human): 7099Help
Entry
7099              CDS       T01001                                 

Gene name
TLR4, ARMD10, CD284, TLR-4, TOLL
Definition
toll-like receptor 4
Orthology
K10160  
toll-like receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Influenza A
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Disease
H00821  
Macular degeneration
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7099 (TLR4)
   04066 HIF-1 signaling pathway
    7099 (TLR4)
   04151 PI3K-Akt signaling pathway
    7099 (TLR4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7099 (TLR4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7099 (TLR4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7099 (TLR4)
  Immune diseases
   05323 Rheumatoid arthritis
    7099 (TLR4)
   05321 Inflammatiory bowel disease (IBD)
    7099 (TLR4)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7099 (TLR4)
   05132 Salmonella infection
    7099 (TLR4)
   05133 Pertussis
    7099 (TLR4)
   05134 Legionellosis
    7099 (TLR4)
   05152 Tuberculosis
    7099 (TLR4)
   05162 Measles
    7099 (TLR4)
   05164 Influenza A
    7099 (TLR4)
   05161 Hepatitis B
    7099 (TLR4)
   05146 Amoebiasis
    7099 (TLR4)
   05144 Malaria
    7099 (TLR4)
   05145 Toxoplasmosis
    7099 (TLR4)
   05140 Leishmaniasis
    7099 (TLR4)
   05142 Chagas disease (American trypanosomiasis)
    7099 (TLR4)
Cellular antigens [BR:hsa04090]
 Proteins
  7099 (TLR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.1
AA seq 799 aa AA seqDB search
MELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQS
LSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHN
LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQP
GAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGL
CNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNC
KFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTS
LKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTR
VAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLS
SLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQND
FACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLS
VLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGV
PPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFL
SSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKS
WNPEGTVGTGCNWQEATSI
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaatttctacaaaatccccgacaacctccccttctcaaccaagaacctggac
ctgagctttaatcccctgaggcatttaggcagctatagcttcttcagtttcccagaactg
caggtgctggatttatccaggtgtgaaatccagacaattgaagatggggcatatcagagc
ctaagccacctctctaccttaatattgacaggaaaccccatccagagtttagccctggga
gccttttctggactatcaagtttacagaagctggtggctgtggagacaaatctagcatct
ctagagaacttccccattggacatctcaaaactttgaaagaacttaatgtggctcacaat
cttatccaatctttcaaattacctgagtatttttctaatctgaccaatctagagcacttg
gacctttccagcaacaagattcaaagtatttattgcacagacttgcgggttctacatcaa
atgcccctactcaatctctctttagacctgtccctgaaccctatgaactttatccaacca
ggtgcatttaaagaaattaggcttcataagctgactttaagaaataattttgatagttta
aatgtaatgaaaacttgtattcaaggtctggctggtttagaagtccatcgtttggttctg
ggagaatttagaaatgaaggaaacttggaaaagtttgacaaatctgctctagagggcctg
tgcaatttgaccattgaagaattccgattagcatacttagactactacctcgatgatatt
attgacttatttaattgtttgacaaatgtttcttcattttccctggtgagtgtgactatt
gaaagggtaaaagacttttcttataatttcggatggcaacatttagaattagttaactgt
aaatttggacagtttcccacattgaaactcaaatctctcaaaaggcttactttcacttcc
aacaaaggtgggaatgctttttcagaagttgatctaccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaaagtgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatggtgttattaccatgagttcaaacttcttgggc
ttagaacaactagaacatctggatttccagcattccaatttgaaacaaatgagtgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatcttcaatggcttgtccagtctcgaagtcttgaaaatggctggc
aattctttccaggaaaacttccttccagatatcttcacagagctgagaaacttgaccttc
ctggacctctctcagtgtcaactggagcagttgtctccaacagcatttaactcactctcc
agtcttcaggtactaaatatgagccacaacaacttcttttcattggatacgtttccttat
aagtgtctgaactccctccaggttcttgattacagtctcaatcacataatgacttccaaa
aaacaggaactacagcattttccaagtagtctagctttcttaaatcttactcagaatgac
tttgcttgtacttgtgaacaccagagtttcctgcaatggatcaaggaccagaggcagctc
ttggtggaagttgaacgaatggaatgtgcaacaccttcagataagcagggcatgcctgtg
ctgagtttgaatatcacctgtcagatgaataagaccatcattggtgtgtcggtcctcagt
gtgcttgtagtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacatctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgagctagtaaagaatttagaagaaggggtg
cctccatttcagctctgccttcactacagagactttattcccggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtgtcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagaccctgctcagg
cagcaggtggagctgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggcggcacatcttctggagacgactcagaaaagccctgctggatggtaaatca
tggaatccagaaggaacagtgggtacaggatgcaattggcaggaagcaacatctatctga

DBGET integrated database retrieval system