KEGG   Homo sapiens (human): 7099Help
Entry
7099              CDS       T01001                                 

Gene name
TLR4, ARMD10, CD284, TLR-4, TOLL
Definition
toll-like receptor 4
Orthology
K10160  
toll-like receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Influenza A
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Disease
H00821  
Macular degeneration
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.1
AA seq 799 aa AA seqDB search
MELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQS
LSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHN
LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQP
GAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGL
CNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNC
KFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTS
LKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTR
VAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLS
SLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQND
FACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLS
VLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGV
PPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFL
SSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKS
WNPEGTVGTGCNWQEATSI
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaatttctacaaaatccccgacaacctccccttctcaaccaagaacctggac
ctgagctttaatcccctgaggcatttaggcagctatagcttcttcagtttcccagaactg
caggtgctggatttatccaggtgtgaaatccagacaattgaagatggggcatatcagagc
ctaagccacctctctaccttaatattgacaggaaaccccatccagagtttagccctggga
gccttttctggactatcaagtttacagaagctggtggctgtggagacaaatctagcatct
ctagagaacttccccattggacatctcaaaactttgaaagaacttaatgtggctcacaat
cttatccaatctttcaaattacctgagtatttttctaatctgaccaatctagagcacttg
gacctttccagcaacaagattcaaagtatttattgcacagacttgcgggttctacatcaa
atgcccctactcaatctctctttagacctgtccctgaaccctatgaactttatccaacca
ggtgcatttaaagaaattaggcttcataagctgactttaagaaataattttgatagttta
aatgtaatgaaaacttgtattcaaggtctggctggtttagaagtccatcgtttggttctg
ggagaatttagaaatgaaggaaacttggaaaagtttgacaaatctgctctagagggcctg
tgcaatttgaccattgaagaattccgattagcatacttagactactacctcgatgatatt
attgacttatttaattgtttgacaaatgtttcttcattttccctggtgagtgtgactatt
gaaagggtaaaagacttttcttataatttcggatggcaacatttagaattagttaactgt
aaatttggacagtttcccacattgaaactcaaatctctcaaaaggcttactttcacttcc
aacaaaggtgggaatgctttttcagaagttgatctaccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaaagtgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatggtgttattaccatgagttcaaacttcttgggc
ttagaacaactagaacatctggatttccagcattccaatttgaaacaaatgagtgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatcttcaatggcttgtccagtctcgaagtcttgaaaatggctggc
aattctttccaggaaaacttccttccagatatcttcacagagctgagaaacttgaccttc
ctggacctctctcagtgtcaactggagcagttgtctccaacagcatttaactcactctcc
agtcttcaggtactaaatatgagccacaacaacttcttttcattggatacgtttccttat
aagtgtctgaactccctccaggttcttgattacagtctcaatcacataatgacttccaaa
aaacaggaactacagcattttccaagtagtctagctttcttaaatcttactcagaatgac
tttgcttgtacttgtgaacaccagagtttcctgcaatggatcaaggaccagaggcagctc
ttggtggaagttgaacgaatggaatgtgcaacaccttcagataagcagggcatgcctgtg
ctgagtttgaatatcacctgtcagatgaataagaccatcattggtgtgtcggtcctcagt
gtgcttgtagtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacatctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgagctagtaaagaatttagaagaaggggtg
cctccatttcagctctgccttcactacagagactttattcccggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtgtcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagaccctgctcagg
cagcaggtggagctgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggcggcacatcttctggagacgactcagaaaagccctgctggatggtaaatca
tggaatccagaaggaacagtgggtacaggatgcaattggcaggaagcaacatctatctga

DBGET integrated database retrieval system