KEGG   Homo sapiens (human): 71Help
Entry
71                CDS       T01001                                 

Gene name
ACTG1, ACT, ACTG, BRWS2, DFNA20, DFNA26
Definition
actin, gamma 1
Orthology
K05692  
actin beta/gamma 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
Hippo signaling pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Bacterial invasion of epithelial cells
Vibrio cholerae infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Influenza A
Proteoglycans in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00604  
Deafness, autosomal dominant
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagagatcgccgcgctggtcattgacaatggctccggcatgtgcaaagctggt
tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgccccagacac
cagggcgtcatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgtggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggccccggaggag
cacccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg
tccctctacgcctctgggcgcaccactggcattgtcatggactctggagacggggtcacc
cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcactgagcgaggctacagcttc
accaccacggccgagcgggaaatcgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccaccgccgcatcctcctcttctctggagaagagctac
gagctgcccgatggccaggtcatcaccattggcaatgagcggttccggtgtccggaggcg
ctgttccagccttccttcctgggtatggaatcttgcggcatccacgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtacgccaacacggtgctgtcg
ggcggcaccaccatgtacccgggcattgccgacaggatgcagaaggagatcaccgccctg
gcgcccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcggtgtgg
atcggtggctccatcctggcctcactgtccaccttccagcagatgtggattagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system