KEGG   Homo sapiens (human): 712Help
Entry
712               CDS       T01001                                 

Gene name
C1QA
Definition
(RefSeq) complement component 1, q subcomponent, A chain
  KO
K03986  
complement C1q subcomponent subunit A
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Prion diseases
Pertussis
Chagas disease (American trypanosomiasis)
Staphylococcus aureus infection
Systemic lupus erythematosus
Disease
H00102  
Classic complement pathway component defects
H01357  
Allergic contact dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    712 (C1QA)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    712 (C1QA)
  Neurodegenerative diseases
   05020 Prion diseases
    712 (C1QA)
  Infectious diseases
   05133 Pertussis
    712 (C1QA)
   05150 Staphylococcus aureus infection
    712 (C1QA)
   05142 Chagas disease (American trypanosomiasis)
    712 (C1QA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.12
AA seq 245 aa AA seqDB search
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR
TGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI
RRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR
GQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFL
IFPSA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagggtccccggggatggctggtgctctgtgtgctggccatatcgctggcctctatg
gtgaccgaggacttgtgccgagcaccagacgggaagaaaggggaggcaggaagacctggc
agacgggggcggccaggcctcaagggggagcaaggggagccgggggcccctggcatccgg
acaggcatccaaggccttaaaggagaccagggggaacctgggccctctggaaaccccggc
aaggtgggctacccagggcccagcggccccctcggagcccgtggcatcccgggaattaaa
ggcaccaagggcagcccaggaaacatcaaggaccagccgaggccagccttctccgccatt
cggcggaaccccccaatggggggcaacgtggtcatcttcgacacggtcatcaccaaccag
gaagaaccgtaccagaaccactccggccgattcgtctgcactgtacccggctactactac
ttcaccttccaggtgctgtcccagtgggaaatctgcctgtccatcgtctcctcctcaagg
ggccaggtccgacgctccctgggcttctgtgacaccaccaacaaggggctcttccaggtg
gtgtcagggggcatggtgcttcagctgcagcagggtgaccaggtctgggttgaaaaagac
cccaaaaagggtcacatttaccagggctctgaggccgacagcgtcttcagcggcttcctc
atcttcccatctgcctga

DBGET integrated database retrieval system