KEGG   Homo sapiens (human): 7122Help
Entry
7122              CDS       T01001                                 

Gene name
CLDN5, AWAL, BEC1, CPETRL1, TMVCF
Definition
claudin 5
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    7122 (CLDN5)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    7122 (CLDN5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7122 (CLDN5)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    7122 (CLDN5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   7122 (CLDN5)
  Exosomal proteins of colorectal cancer cells
   7122 (CLDN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 303 aa AA seqDB search
MTRARIGCFGPGGRARGTESAPEPSKRVPPGRSWQTQEVRQTRGANGLGPRAGSAGAKAP
GPAQGAAQHGLGGSAGLRVRVSPLAMGSAALEILGLVLCLVGWGGLILACGLPMWQVTAF
LDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVAL
FVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVS
QKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKK
NYV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcacggattggctgcttcgggccggggggccgggcccgggggacagaatcc
gcccccgaaccttcaaagagggtaccccccggcaggagctggcagacccaggaggtgcga
cagacccgcggggcaaacggactggggccaagagccgggagcgcgggcgcaaaggcacca
gggcccgcccagggcgccgcgcagcacggccttgggggttctgcgggccttcgggtgcgc
gtctcgcctctagccatggggtccgcagcgttggagatcctgggcctggtgctgtgcctg
gtgggctgggggggtctgatcctggcgtgcgggctgcccatgtggcaggtgaccgccttc
ctggaccacaacatcgtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtg
gtgcagagcaccgggcacatgcagtgcaaagtgtacgactcggtgctggctctgagcacc
gaggtgcaggcggcgcgggcgctcaccgtgagcgccgtgctgctggcgttcgttgcgctc
ttcgtgaccctggcgggcgcgcagtgcaccacctgcgtggccccgggcccggccaaggcg
cgtgtggccctcacgggaggcgtgctctacctgttttgcgggctgctggcgctcgtgcca
ctctgctggttcgccaacattgtcgtccgcgagttttacgacccgtctgtgcccgtgtcg
cagaagtacgagctgggcgcagcgctgtacatcggctgggcggccaccgcgctgctcatg
gtaggcggctgcctcttgtgctgcggcgcctgggtctgcaccggccgtcccgacctcagc
ttccccgtgaagtactcagcgccgcggcggcccacggccaccggcgactacgacaagaag
aactacgtctga

DBGET integrated database retrieval system