KEGG   Homo sapiens (human): 7122Help
Entry
7122              CDS       T01001                                 

Gene name
CLDN5, AWAL, BEC1, CPETRL1, TMVCF
Definition
(RefSeq) claudin 5
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    7122 (CLDN5)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    7122 (CLDN5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7122 (CLDN5)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    7122 (CLDN5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   7122 (CLDN5)
  Exosomal proteins of colorectal cancer cells
   7122 (CLDN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Motif
Other DBs
NCBI-GeneID: 7122
NCBI-ProteinID: NP_001124333
OMIM: 602101
HGNC: 2047
Ensembl: ENSG00000184113
Vega: OTTHUMG00000150441
Pharos: O00501(Tbio)
UniProt: O00501 D3DX19
Position
22q11.21
AA seq 303 aa AA seqDB search
MTRARIGCFGPGGRARGTESAPEPSKRVPPGRSWQTQEVRQTRGANGLGPRAGSAGAKAP
GPAQGAAQHGLGGSAGLRVRVSPLAMGSAALEILGLVLCLVGWGGLILACGLPMWQVTAF
LDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVAL
FVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVS
QKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKK
NYV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcacggattggctgcttcgggccggggggccgggcccgggggacagaatcc
gcccccgaaccttcaaagagggtaccccccggcaggagctggcagacccaggaggtgcga
cagacccgcggggcaaacggactggggccaagagccgggagcgcgggcgcaaaggcacca
gggcccgcccagggcgccgcgcagcacggccttgggggttctgcgggccttcgggtgcgc
gtctcgcctctagccatggggtccgcagcgttggagatcctgggcctggtgctgtgcctg
gtgggctgggggggtctgatcctggcgtgcgggctgcccatgtggcaggtgaccgccttc
ctggaccacaacatcgtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtg
gtgcagagcaccgggcacatgcagtgcaaagtgtacgactcggtgctggctctgagcacc
gaggtgcaggcggcgcgggcgctcaccgtgagcgccgtgctgctggcgttcgttgcgctc
ttcgtgaccctggcgggcgcgcagtgcaccacctgcgtggccccgggcccggccaaggcg
cgtgtggccctcacgggaggcgtgctctacctgttttgcgggctgctggcgctcgtgcca
ctctgctggttcgccaacattgtcgtccgcgagttttacgacccgtctgtgcccgtgtcg
cagaagtacgagctgggcgcagcgctgtacatcggctgggcggccaccgcgctgctcatg
gtaggcggctgcctcttgtgctgcggcgcctgggtctgcaccggccgtcccgacctcagc
ttccccgtgaagtactcagcgccgcggcggcccacggccaccggcgactacgacaagaag
aactacgtctga

DBGET integrated database retrieval system