KEGG   Homo sapiens (human): 7122Help
Entry
7122              CDS       T01001                                 

Gene name
CLDN5, AWAL, BEC1, CPETRL1, TMVCF
Definition
claudin 5
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 303 aa AA seqDB search
MTRARIGCFGPGGRARGTESAPEPSKRVPPGRSWQTQEVRQTRGANGLGPRAGSAGAKAP
GPAQGAAQHGLGGSAGLRVRVSPLAMGSAALEILGLVLCLVGWGGLILACGLPMWQVTAF
LDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVAL
FVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVS
QKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKK
NYV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcacggattggctgcttcgggccggggggccgggcccgggggacagaatcc
gcccccgaaccttcaaagagggtaccccccggcaggagctggcagacccaggaggtgcga
cagacccgcggggcaaacggactggggccaagagccgggagcgcgggcgcaaaggcacca
gggcccgcccagggcgccgcgcagcacggccttgggggttctgcgggccttcgggtgcgc
gtctcgcctctagccatggggtccgcagcgttggagatcctgggcctggtgctgtgcctg
gtgggctgggggggtctgatcctggcgtgcgggctgcccatgtggcaggtgaccgccttc
ctggaccacaacatcgtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtg
gtgcagagcaccgggcacatgcagtgcaaagtgtacgactcggtgctggctctgagcacc
gaggtgcaggcggcgcgggcgctcaccgtgagcgccgtgctgctggcgttcgttgcgctc
ttcgtgaccctggcgggcgcgcagtgcaccacctgcgtggccccgggcccggccaaggcg
cgtgtggccctcacgggaggcgtgctctacctgttttgcgggctgctggcgctcgtgcca
ctctgctggttcgccaacattgtcgtccgcgagttttacgacccgtctgtgcccgtgtcg
cagaagtacgagctgggcgcagcgctgtacatcggctgggcggccaccgcgctgctcatg
gtaggcggctgcctcttgtgctgcggcgcctgggtctgcaccggccgtcccgacctcagc
ttccccgtgaagtactcagcgccgcggcggcccacggccaccggcgactacgacaagaag
aactacgtctga

DBGET integrated database retrieval system