KEGG   Homo sapiens (human): 7124Help
Entry
7124              CDS       T01001                                 

Gene name
TNF, DIF, TNF-alpha, TNFA, TNFSF2
Definition
tumor necrosis factor
Orthology
K03156  
tumor necrosis factor superfamily, member 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
mTOR signaling pathway
Apoptosis
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Hematopoietic cell lineage
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Proteoglycans in cancer
Asthma
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00079  
Asthma
H00080  
Systemic lupus erythematosus
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
Drug target
Etanercept: 
Infliximab: 
Afelimomab: 
Adalimumab: 
Certolizumab pegol: 
Golimumab: 
Lenalidomide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7124 (TNF)
   04350 TGF-beta signaling pathway
    7124 (TNF)
   04064 NF-kappa B signaling pathway
    7124 (TNF)
   04668 TNF signaling pathway
    7124 (TNF)
   04150 mTOR signaling pathway
    7124 (TNF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7124 (TNF)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    7124 (TNF)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7124 (TNF)
   04620 Toll-like receptor signaling pathway
    7124 (TNF)
   04621 NOD-like receptor signaling pathway
    7124 (TNF)
   04622 RIG-I-like receptor signaling pathway
    7124 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    7124 (TNF)
   04612 Antigen processing and presentation
    7124 (TNF)
   04660 T cell receptor signaling pathway
    7124 (TNF)
   04664 Fc epsilon RI signaling pathway
    7124 (TNF)
  Endocrine system
   04920 Adipocytokine signaling pathway
    7124 (TNF)
  Development
   04380 Osteoclast differentiation
    7124 (TNF)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7124 (TNF)
  Immune diseases
   05310 Asthma
    7124 (TNF)
   05322 Systemic lupus erythematosus
    7124 (TNF)
   05323 Rheumatoid arthritis
    7124 (TNF)
   05321 Inflammatiory bowel disease (IBD)
    7124 (TNF)
   05330 Allograft rejection
    7124 (TNF)
   05332 Graft-versus-host disease
    7124 (TNF)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7124 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    7124 (TNF)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7124 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    7124 (TNF)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    7124 (TNF)
   04930 Type II diabetes mellitus
    7124 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7124 (TNF)
  Infectious diseases
   05133 Pertussis
    7124 (TNF)
   05134 Legionellosis
    7124 (TNF)
   05152 Tuberculosis
    7124 (TNF)
   05166 HTLV-I infection
    7124 (TNF)
   05164 Influenza A
    7124 (TNF)
   05161 Hepatitis B
    7124 (TNF)
   05160 Hepatitis C
    7124 (TNF)
   05168 Herpes simplex infection
    7124 (TNF)
   05146 Amoebiasis
    7124 (TNF)
   05144 Malaria
    7124 (TNF)
   05145 Toxoplasmosis
    7124 (TNF)
   05140 Leishmaniasis
    7124 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    7124 (TNF)
   05143 African trypanosomiasis
    7124 (TNF)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  7124 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 233 aa AA seqDB search
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system