KEGG   Homo sapiens (human): 7125Help
Entry
7125              CDS       T01001                                 

Gene name
TNNC2
Definition
(RefSeq) troponin C2, fast skeletal type
  KO
K12042  
troponin C, skeletal muscle
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7125 (TNNC2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7125 (TNNC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q12-q13.11
AA seq 160 aa AA seqDB search
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccagcaggctgaggccaggtcctacctcagcgaagagatgatcgctgagttc
aaggctgcctttgacatgtttgatgctgatggtggtggggacatcagcgtcaaggagttg
ggcacggtgatgaggatgctgggccagacacccaccaaggaggagctggacgccatcatc
gaggaggtggatgaggacggcagcggcaccatcgacttcgaggagttcttggtcatgatg
gtgcgccagatgaaagaggacgcgaaagggaagagcgaggaggagctggccgagtgcttc
cgcatcttcgacaggaatgcagacggctacatcgacccggaggagctggctgagattttc
agggcctccggggagcacgtgacggacgaggagatcgaatctctgatgaaagacggcgac
aagaacaacgacggccgcattgacttcgacgagttcctgaagatgatggagggcgtgcag
taa

DBGET integrated database retrieval system