KEGG   Homo sapiens (human): 7125Help
Entry
7125              CDS       T01001                                 

Gene name
TNNC2
Definition
troponin C type 2 (fast)
Orthology
K12042  
troponin C, skeletal muscle
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q12-q13.11
AA seq 160 aa AA seqDB search
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccagcaggctgaggccaggtcctacctcagcgaagagatgatcgctgagttc
aaggctgcctttgacatgtttgatgctgatggtggtggggacatcagcgtcaaggagttg
ggcacggtgatgaggatgctgggccagacacccaccaaggaggagctggacgccatcatc
gaggaggtggatgaggacggcagcggcaccatcgacttcgaggagttcttggtcatgatg
gtgcgccagatgaaagaggacgcgaaagggaagagcgaggaggagctggccgagtgcttc
cgcatcttcgacaggaatgcagacggctacatcgacccggaggagctggctgagattttc
agggcctccggggagcacgtgacggacgaggagatcgaatctctgatgaaagacggcgac
aagaacaacgacggccgcattgacttcgacgagttcctgaagatgatggagggcgtgcag
taa

DBGET integrated database retrieval system