KEGG   Homo sapiens (human): 7132Help
Entry
7132              CDS       T01001                                 

Gene name
TNFRSF1A, CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05418  Fluid shear stress and atherosclerosis
Network
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00193  HPV E6 to host-cell-protein inhibition
Disease
H00912  Tumor necrosis factor receptor-associated periodic syndrome (TRAPS)
H01490  Multiple sclerosis
Drug target
Tasonermin: D08562
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7132 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    7132 (TNFRSF1A)
   04668 TNF signaling pathway
    7132 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    7132 (TNFRSF1A)
   04150 mTOR signaling pathway
    7132 (TNFRSF1A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7132 (TNFRSF1A)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    7132 (TNFRSF1A)
   04215 Apoptosis - multiple species
    7132 (TNFRSF1A)
   04217 Necroptosis
    7132 (TNFRSF1A)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    7132 (TNFRSF1A)
  Development
   04380 Osteoclast differentiation
    7132 (TNFRSF1A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7132 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    7132 (TNFRSF1A)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7132 (TNFRSF1A)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7132 (TNFRSF1A)
   04931 Insulin resistance
    7132 (TNFRSF1A)
  Infectious diseases
   05152 Tuberculosis
    7132 (TNFRSF1A)
   05166 HTLV-I infection
    7132 (TNFRSF1A)
   05164 Influenza A
    7132 (TNFRSF1A)
   05160 Hepatitis C
    7132 (TNFRSF1A)
   05168 Herpes simplex infection
    7132 (TNFRSF1A)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    7132 (TNFRSF1A)
   05165 Human papillomavirus infection
    7132 (TNFRSF1A)
   05145 Toxoplasmosis
    7132 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    7132 (TNFRSF1A)
Cytokine receptors [BR:hsa04050]
 TNF receptor family
  7132 (TNFRSF1A)
CD molecules [BR:hsa04090]
 Proteins
  7132 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 7132
NCBI-ProteinID: NP_001056
OMIM: 191190
HGNC: 11916
Ensembl: ENSG00000067182
Vega: OTTHUMG00000168267
Pharos: P19438(Tchem)
UniProt: P19438
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 455 aa AA seqDB search
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctaggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattcgatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagaaaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggtcaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcaggtttctttctaagagaaaacgagtgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacgaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcattttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaacccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccgtgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaactttgcggctccccgcagagaggtggcaccaccctatcagggg
gctgaccccatccttgcgacagccctcgcctccgaccccatccccaacccccttcagaag
tgggaggacagcgcccacaagccacagagcctagacactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccagtcttctcagatga

DBGET integrated database retrieval system