KEGG   Homo sapiens (human): 7132Help
Entry
7132              CDS       T01001                                 

Gene name
TNFRSF1A, CD120a, FPF, MS5, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR1-d2, TNFR55, TNFR60, p55, p55-R, p60
Definition
tumor necrosis factor receptor superfamily, member 1A
Orthology
K03158  
tumor necrosis factor receptor superfamily member 1A
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
HTLV-I infection
Herpes simplex infection
Disease
H00912  
Tumor necrosis factor receptor-associated periodic syndrome (TRAPS)
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.2
AA seq 455 aa AA seqDB search
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctaggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattcgatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagaaaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggtcaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcaggtttctttctaagagaaaacgagtgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacgaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcattttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaacccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccgtgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaactttgcggctccccgcagagaggtggcaccaccctatcagggg
gctgaccccatccttgcgacagccctcgcctccgaccccatccccaacccccttcagaag
tgggaggacagcgcccacaagccacagagcctagacactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccagtcttctcagatga

DBGET integrated database retrieval system