KEGG   Homo sapiens (human): 7134Help
Entry
7134              CDS       T01001                                 

Gene name
TNNC1, CMD1Z, CMH13, TN-C, TNC, TNNC
Definition
troponin C type 1 (slow)
Orthology
K05865  
troponin C, slow skeletal and cardiac muscles
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7134 (TNNC1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7134 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    7134 (TNNC1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7134 (TNNC1)
   05414 Dilated cardiomyopathy (DCM)
    7134 (TNNC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.1
AA seq 161 aa AA seqDB search
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaggcagccttcgacatcttcgtgctgggcgctgaggatggctgcatcagcaccaaggag
ctgggcaaggtgatgaggatgctgggccagaaccccacccctgaggagctgcaggagatg
atcgatgaggtggacgaggacggcagcggcacggtggactttgatgagttcctggtcatg
atggttcggtgcatgaaggacgacagcaaagggaaatctgaggaggagctgtctgacctc
ttccgcatgtttgacaaaaatgctgatggctacatcgacctggatgagctgaagataatg
ctgcaggctacaggcgagaccatcacggaggacgacatcgaggagctcatgaaggacgga
gacaagaacaacgacggccgcatcgactatgatgagttcctggagttcatgaagggtgtg
gagtag

DBGET integrated database retrieval system