KEGG   Homo sapiens (human): 7153Help
Entry
7153              CDS       T01001                                 

Gene name
TOP2A, TOP2, TP2A
Definition
(RefSeq) topoisomerase (DNA) II alpha (EC:5.99.1.3)
  KO
K03164  
DNA topoisomerase II [EC:5.99.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Drug target
Aclarubicin (DG00699): 
Aldoxorubicin (DG01726): 
Amonafide (DG01268): 
Amrubicin (DG00703): 
Amsacrine: 
Berubicin hydrochloride: 
Crisnatol mesylate: 
Daunorubicin (DG00697): 
Doxorubicin (DG00696): 
Epirubicin (DG00698): 
Etoposide (DG00693): 
Fostriecin sodium: 
Idarubicin (DG00700): 
Idronoxil: 
Ledoxantrone trihydrochloride: 
Losoxantrone hydrochloride: 
Lucanthone hydrochloride: 
Mitoxantrone (DG00701): 
Pirarubicin (DG00702): 
Pixantrone (DG00704): 
Quarfloxin: 
Sobuzoxane: 
Teniposide: 
Vosaroxin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Drug resistance
   01524 Platinum drug resistance
    7153 (TOP2A)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     7153 (TOP2A)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Topoisomerases
   7153 (TOP2A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    7153 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    7153 (TOP2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 1531 aa AA seqDB search
MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK
KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA
ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE
ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG
TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgtcaccattgcagcctgtaaatgaaaatatgcaagtcaacaaaataaagaaa
aatgaagatgctaagaaaagactgtctgttgaaagaatctatcaaaagaaaacacaattg
gaacatattttgctccgcccagacacctacattggttctgtggaattagtgacccagcaa
atgtgggtttacgatgaagatgttggcattaactatagggaagtcacttttgttcctggt
ttgtacaaaatctttgatgagattctagttaatgctgcggacaacaaacaaagggaccca
aaaatgtcttgtattagagtcacaattgatccggaaaacaatttaattagtatatggaat
aatggaaaaggtattcctgttgttgaacacaaagttgaaaagatgtatgtcccagctctc
atatttggacagctcctaacttctagtaactatgatgatgatgaaaagaaagtgacaggt
ggtcgaaatggctatggagccaaattgtgtaacatattcagtaccaaatttactgtggaa
acagccagtagagaatacaagaaaatgttcaaacagacatggatggataatatgggaaga
gctggtgagatggaactcaagcccttcaatggagaagattatacatgtatcacctttcag
cctgatttgtctaagtttaaaatgcaaagcctggacaaagatattgttgcactaatggtc
agaagagcatatgatattgctggatccaccaaagatgtcaaagtctttcttaatggaaat
aaactgccagtaaaaggatttcgtagttatgtggacatgtatttgaaggacaagttggat
gaaactggtaactccttgaaagtaatacatgaacaagtaaaccacaggtgggaagtgtgt
ttaactatgagtgaaaaaggctttcagcaaattagctttgtcaacagcattgctacatcc
aagggtggcagacatgttgattatgtagctgatcagattgtgactaaacttgttgatgtt
gtgaagaagaagaacaagggtggtgttgcagtaaaagcacatcaggtgaaaaatcacatg
tggatttttgtaaatgccttaattgaaaacccaacctttgactctcagacaaaagaaaac
atgactttacaacccaagagctttggatcaacatgccaattgagtgaaaaatttatcaaa
gctgccattggctgtggtattgtagaaagcatactaaactgggtgaagtttaaggcccaa
gtccagttaaacaagaagtgttcagctgtaaaacataatagaatcaagggaattcccaaa
ctcgatgatgccaatgatgcagggggccgaaactccactgagtgtacgcttatcctgact
gagggagattcagccaaaactttggctgtttcaggccttggtgtggttgggagagacaaa
tatggggttttccctcttagaggaaaaatactcaatgttcgagaagcttctcataagcag
atcatggaaaatgctgagattaacaatatcatcaagattgtgggtcttcagtacaagaaa
aactatgaagatgaagattcattgaagacgcttcgttatgggaagataatgattatgaca
gatcaggaccaagatggttcccacatcaaaggcttgctgattaattttatccatcacaac
tggccctctcttctgcgacatcgttttctggaggaatttatcactcccattgtaaaggta
tctaaaaacaagcaagaaatggcattttacagccttcctgaatttgaagagtggaagagt
tctactccaaatcataaaaaatggaaagtcaaatattacaaaggtttgggcaccagcaca
tcaaaggaagctaaagaatactttgcagatatgaaaagacatcgtatccagttcaaatat
tctggtcctgaagatgatgctgctatcagcctggcctttagcaaaaaacagatagatgat
cgaaaggaatggttaactaatttcatggaggatagaagacaacgaaagttacttgggctt
cctgaggattacttgtatggacaaactaccacatatctgacatataatgacttcatcaac
aaggaacttatcttgttctcaaattctgataacgagagatctatcccttctatggtggat
ggtttgaaaccaggtcagagaaaggttttgtttacttgcttcaaacggaatgacaagcga
gaagtaaaggttgcccaattagctggatcagtggctgaaatgtcttcttatcatcatggt
gagatgtcactaatgatgaccattatcaatttggctcagaattttgtgggtagcaataat
ctaaacctcttgcagcccattggtcagtttggtaccaggctacatggtggcaaggattct
gctagtccacgatacatctttacaatgctcagctctttggctcgattgttatttccacca
aaagatgatcacacgttgaagtttttatatgatgacaaccagcgtgttgagcctgaatgg
tacattcctattattcccatggtgctgataaatggtgctgaaggaatcggtactgggtgg
tcctgcaaaatccccaactttgatgtgcgtgaaattgtaaataacatcaggcgtttgatg
gatggagaagaacctttgccaatgcttccaagttacaagaacttcaagggtactattgaa
gaactggctccaaatcaatatgtgattagtggtgaagtagctattcttaattctacaacc
attgaaatctcagagcttcccgtcagaacatggacccagacatacaaagaacaagttcta
gaacccatgttgaatggcaccgagaagacacctcctctcataacagactatagggaatac
catacagataccactgtgaaatttgttgtgaagatgactgaagaaaaactggcagaggca
gagagagttggactacacaaagtcttcaaactccaaactagtctcacatgcaactctatg
gtgctttttgaccacgtaggctgtttaaagaaatatgacacggtgttggatattctaaga
gacttttttgaactcagacttaaatattatggattaagaaaagaatggctcctaggaatg
cttggtgctgaatctgctaaactgaataatcaggctcgctttatcttagagaaaatagat
ggcaaaataatcattgaaaataagcctaagaaagaattaattaaagttctgattcagagg
ggatatgattcggatcctgtgaaggcctggaaagaagcccagcaaaaggttccagatgaa
gaagaaaatgaagagagtgacaacgaaaaggaaactgaaaagagtgactccgtaacagat
tctggaccaaccttcaactatcttcttgatatgcccctttggtatttaaccaaggaaaag
aaagatgaactctgcaggctaagaaatgaaaaagaacaagagctggacacattaaaaaga
aagagtccatcagatttgtggaaagaagacttggctacatttattgaagaattggaggct
gttgaagccaaggaaaaacaagatgaacaagtcggacttcctgggaaaggggggaaggcc
aaggggaaaaaaacacaaatggctgaagttttgccttctccgcgtggtcaaagagtcatt
ccacgaataaccatagaaatgaaagcagaggcagaaaagaaaaataaaaagaaaattaag
aatgaaaatactgaaggaagccctcaagaagatggtgtggaactagaaggcctaaaacaa
agattagaaaagaaacagaaaagagaaccaggtacaaagacaaagaaacaaactacattg
gcatttaagccaatcaaaaaaggaaagaagagaaatccctggtctgattcagaatcagat
aggagcagtgacgaaagtaattttgatgtccctccacgagaaacagagccacggagagca
gcaacaaaaacaaaattcacaatggatttggattcagatgaagatttctcagattttgat
gaaaaaactgatgatgaagattttgtcccatcagatgctagtccacctaagaccaaaact
tccccaaaacttagtaacaaagaactgaaaccacagaaaagtgtcgtgtcagaccttgaa
gctgatgatgttaagggcagtgtaccactgtcttcaagccctcctgctacacatttccca
gatgaaactgaaattacaaacccagttcctaaaaagaatgtgacagtgaagaagacagca
gcaaaaagtcagtcttccacctccactaccggtgccaaaaaaagggctgccccaaaagga
actaaaagggatccagctttgaattctggtgtctctcaaaagcctgatcctgccaaaacc
aagaatcgccgcaaaaggaagccatccacttctgatgattctgactctaattttgagaaa
attgtttcgaaagcagtcacaagcaagaaatccaagggggagagtgatgacttccatatg
gactttgactcagctgtggctcctcgggcaaaatctgtacgggcaaagaaacctataaag
tacctggaagagtcagatgaagatgatctgttttaa

DBGET integrated database retrieval system