KEGG   Homo sapiens (human): 7161Help
Entry
7161              CDS       T01001                                 

Gene name
TP73, P73
Definition
(RefSeq) tumor protein p73
  KO
K10148  
tumor protein p73
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Hippo signaling pathway
Neurotrophin signaling pathway
Measles
Disease
H00048  
Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7161 (TP73)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    7161 (TP73)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    7161 (TP73)
 Human Diseases
  Infectious diseases
   05162 Measles
    7161 (TP73)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    7161 (TP73)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.3
AA seq 636 aa AA seqDB search
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtccaccgccacctcccctgatgggggcaccacgtttgagcacctctggagc
tctctggaaccagacagcacctacttcgaccttccccagtcaagccgggggaataatgag
gtggtgggcggaacggattccagcatggacgtcttccacctggagggcatgactacatct
gtcatggcccagttcaatctgctgagcagcaccatggaccagatgagcagccgcgcggcc
tcggccagcccctacaccccagagcacgccgccagcgtgcccacccactcgccctacgca
caacccagctccaccttcgacaccatgtcgccggcgcctgtcatcccctccaacaccgac
taccccggaccccaccactttgaggtcactttccagcagtccagcacggccaagtcagcc
acctggacgtactccccgctcttgaagaaactctactgccagatcgccaagacatgcccc
atccagatcaaggtgtccaccccgccacccccaggcaccgccatccgggccatgcctgtt
tacaagaaagcggagcacgtgaccgacgtcgtgaaacgctgccccaaccacgagctcggg
agggacttcaacgaaggacagtctgctccagccagccacctcatccgcgtggaaggcaat
aatctctcgcagtatgtggatgaccctgtcaccggcaggcagagcgtcgtggtgccctat
gagccaccacaggtggggacggaattcaccaccatcctgtacaacttcatgtgtaacagc
agctgtgtagggggcatgaaccggcggcccatcctcatcatcatcaccctggagatgcgg
gatgggcaggtgctgggccgccggtcctttgagggccgcatctgcgcctgtcctggccgc
gaccgaaaagctgatgaggaccactaccgggagcagcaggccctgaacgagagctccgcc
aagaacggggccgccagcaagcgtgccttcaagcagagcccccctgccgtccccgccctt
ggtgccggtgtgaagaagcggcggcatggagacgaggacacgtactaccttcaggtgcga
ggccgggagaactttgagatcctgatgaagctgaaagagagcctggagctgatggagttg
gtgccgcagccactggtggactcctatcggcagcagcagcagctcctacagaggccgagt
cacctacagcccccgtcctacgggccggtcctctcgcccatgaacaaggtgcacgggggc
atgaacaagctgccctccgtcaaccagctggtgggccagcctcccccgcacagttcggca
gctacacccaacctggggcccgtgggccccgggatgctcaacaaccatggccacgcagtg
ccagccaacggcgagatgagcagcagccacagcgcccagtccatggtctcggggtcccac
tgcactccgccacccccctaccacgccgaccccagcctcgtcagttttttaacaggattg
gggtgtccaaactgcatcgagtatttcacctcccaagggttacagagcatttaccacctg
cagaacctgaccattgaggacctgggggccctgaagatccccgagcagtaccgcatgacc
atctggcggggcctgcaggacctgaagcagggccacgactacagcaccgcgcagcagctg
ctccgctctagcaacgcggccaccatctccatcggcggctcaggggaactgcagcgccag
cgggtcatggaggccgtgcacttccgcgtgcgccacaccatcaccatccccaaccgcggc
ggcccaggcggcggccctgacgagtgggcggacttcggcttcgacctgcccgactgcaag
gcccgcaagcagcccatcaaggaggagttcacggaggccgagatccactga

DBGET integrated database retrieval system