KEGG   Homo sapiens (human): 7166Help
Entry
7166              CDS       T01001                                 

Gene name
TPH1, TPRH, TRPH, TPH
Definition
tryptophan hydroxylase 1 (EC:1.14.16.4)
Orthology
K00502  
tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    7166 (TPH1)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    7166 (TPH1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.4  tryptophan 5-monooxygenase
     7166 (TPH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.3-p14
AA seq 444 aa AA seqDB search
MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEF
EIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCAN
RVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQE
LNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRD
FLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGA
SEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITC
KQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA
MNELQHDLDVVSDALAKVSRKPSI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagacaataaggagaacaaagaccattccttagaaaggggaagagcaagtctc
attttttccttaaagaatgaagttggaggacttataaaagccctgaaaatctttcaggag
aagcatgtgaatctgttacatatcgagtcccgaaaatcaaaaagaagaaactcagaattt
gagatttttgttgactgtgacatcaacagagaacaattgaatgatatttttcatctgctg
aagtctcataccaatgttctctctgtgaatctaccagataattttactttgaaggaagat
ggtatggaaactgttccttggtttccaaagaagatttctgacctggaccattgtgccaac
agagttctgatgtatggatctgaactagatgcagaccatcctggcttcaaagacaatgtc
taccgtaaacgtcgaaagtattttgcggacttggctatgaactataaacatggagacccc
attccaaaggttgaattcactgaagaggagattaagacctggggaaccgtattccaagag
ctcaacaaactctacccaacccatgcttgcagagagtatctcaaaaacttacctttgctt
tctaaatattgtggatatcgggaggataatatcccacaattggaagatgtctccaacttt
ttaaaagagcgtacaggtttttccatccgtcctgtggctggttacttatcaccaagagat
ttcttatcaggtttagcctttcgagtttttcactgcactcaatatgtgagacacagttca
gatcccttctataccccagagccagatacctgccatgaactcttaggtcatgtcccgctt
ttggctgaacctagttttgcccaattctcccaagaaattggcttggcttctcttggcgct
tcagaggaggctgttcaaaaactggcaacgtgctactttttcactgtggagtttggtcta
tgtaaacaagatggacagctaagagtctttggtgctggcttactttcttctatcagtgaa
ctcaaacatgcactttctggacatgccaaagtaaagccctttgatcccaagattacctgc
aaacaggaatgtcttatcacaacttttcaagatgtctactttgtatctgaaagttttgaa
gatgcaaaggagaagatgagagaatttaccaaaacaattaagcgtccatttggagtgaag
tataatccatatacacggagtattcagatcctgaaagacaccaagagcataaccagtgcc
atgaatgagctgcagcatgatctcgatgttgtcagtgatgcccttgctaaggtcagcagg
aagccgagtatctaa

DBGET integrated database retrieval system