KEGG   Homo sapiens (human): 7166Help
Entry
7166              CDS       T01001                                 

Gene name
TPH1, TPRH, TRPH, TPH
Definition
tryptophan hydroxylase 1 (EC:1.14.16.4)
Orthology
K00502  
tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.3-p14
AA seq 444 aa AA seqDB search
MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEF
EIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCAN
RVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQE
LNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRD
FLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGA
SEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITC
KQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA
MNELQHDLDVVSDALAKVSRKPSI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagacaataaggagaacaaagaccattccttagaaaggggaagagcaagtctc
attttttccttaaagaatgaagttggaggacttataaaagccctgaaaatctttcaggag
aagcatgtgaatctgttacatatcgagtcccgaaaatcaaaaagaagaaactcagaattt
gagatttttgttgactgtgacatcaacagagaacaattgaatgatatttttcatctgctg
aagtctcataccaatgttctctctgtgaatctaccagataattttactttgaaggaagat
ggtatggaaactgttccttggtttccaaagaagatttctgacctggaccattgtgccaac
agagttctgatgtatggatctgaactagatgcagaccatcctggcttcaaagacaatgtc
taccgtaaacgtcgaaagtattttgcggacttggctatgaactataaacatggagacccc
attccaaaggttgaattcactgaagaggagattaagacctggggaaccgtattccaagag
ctcaacaaactctacccaacccatgcttgcagagagtatctcaaaaacttacctttgctt
tctaaatattgtggatatcgggaggataatatcccacaattggaagatgtctccaacttt
ttaaaagagcgtacaggtttttccatccgtcctgtggctggttacttatcaccaagagat
ttcttatcaggtttagcctttcgagtttttcactgcactcaatatgtgagacacagttca
gatcccttctataccccagagccagatacctgccatgaactcttaggtcatgtcccgctt
ttggctgaacctagttttgcccaattctcccaagaaattggcttggcttctcttggcgct
tcagaggaggctgttcaaaaactggcaacgtgctactttttcactgtggagtttggtcta
tgtaaacaagatggacagctaagagtctttggtgctggcttactttcttctatcagtgaa
ctcaaacatgcactttctggacatgccaaagtaaagccctttgatcccaagattacctgc
aaacaggaatgtcttatcacaacttttcaagatgtctactttgtatctgaaagttttgaa
gatgcaaaggagaagatgagagaatttaccaaaacaattaagcgtccatttggagtgaag
tataatccatatacacggagtattcagatcctgaaagacaccaagagcataaccagtgcc
atgaatgagctgcagcatgatctcgatgttgtcagtgatgcccttgctaaggtcagcagg
aagccgagtatctaa

DBGET integrated database retrieval system