KEGG   Homo sapiens (human): 7167Help
Entry
7167              CDS       T01001                                 

Gene name
TPI1, HEL-S-49, TIM, TPI, TPID
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00664  
Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    7167 (TPI1)
   01230 Biosynthesis of amino acids
    7167 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7167 (TPI1)
   00051 Fructose and mannose metabolism
    7167 (TPI1)
   00562 Inositol phosphate metabolism
    7167 (TPI1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     7167 (TPI1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   7167 (TPI1)
  Exosomal proteins of bladder cancer cells
   7167 (TPI1)
  Exosomal proteins of melanoma cells
   7167 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttgggggaaactggaagatgaacgggcggaagcag
agtctgggggagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtg
gtttgtgctccccctactgcctatatcgacttcgcccggcagaagctagatcccaagatt
gctgtggctgcgcagaactgctacaaagtgactaatggggcttttactggggagatcagc
cctggcatgatcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagag
ggactcggagtaatcgcctgcattggggagaagctagatgaaagggaagctggcatcact
gagaaggttgttttcgagcagacaaaggtcatcgcagataacgtgaaggactggagcaag
gtcgtcctggcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaa
caggcccaggaagtacacgagaagctccgaggatggctgaagtccaacgtctctgatgcg
gtggctcagagcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggag
ctggccagccagcctgatgtggatggcttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system