KEGG   Homo sapiens (human): 7168Help
Entry
7168              CDS       T01001                                 

Gene name
TPM1, C15orf13, CMD1Y, CMH3, HTM-alpha, LVNC9, TMSA
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7168 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    7168 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    7168 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7168 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    7168 (TPM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   7168 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.1
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagctgagcaggcggaggccgacaagaaggcggcggaagacaggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tctgaggctctcaaagatgcccaggagaagctggagctggcagagaaaaaggccaccgat
gctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggccaagtccgacagctggaagaacaattaagaataatg
gatcagaccttgaaagcattaatggctgcagaggataagtactcgcagaaggaagacaga
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system