KEGG   Homo sapiens (human): 7169Help
Entry
7169              CDS       T01001                                 

Gene name
TPM2, AMCD1, DA1, DA2B, HEL-S-273, NEM4, TMSB
Definition
tropomyosin 2 (beta)
Orthology
K10374  
tropomyosin 2
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00698  
Nemaline myopathy
H00702  
Cap myopathy
H00811  
Distal arthrogryposis (DA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7169 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    7169 (TPM2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7169 (TPM2)
   05414 Dilated cardiomyopathy (DCM)
    7169 (TPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccatcgac
cgcgccgagcaggccgaagccgacaagaagcaagctgaggaccgctgcaagcagctggag
gaggagcagcaggccctccagaagaagctgaaggggacagaggatgaggtggaaaagtat
tctgaatccgtgaaggaggcccaggagaaactggagcaggccgagaagaaggccactgat
gctgaggcagatgtggcctccctgaaccgccgcattcagctggttgaggaggagctggac
cgggcccaggagcgcctggctacagccctgcagaagctggaggaggccgagaaggcggct
gatgagagcgagagaggaatgaaggtcatcgaaaaccgggccatgaaggatgaggagaag
atggaactgcaggagatgcagctgaaggaggccaagcacatcgctgaggattcagaccgc
aaatatgaagaggtggccaggaagctggtgatcctggaaggagagctggagcgctcggag
gagagggctgaggtggccgagagtaaatgtggggacctagaggaggagctgaaaattgtt
accaacaacttgaaatccctggaggcccaggcggacaagtattccaccaaagaagataaa
tatgaagaggagatcaaactgttggaggagaagctgaaggaggctgagacccgagcagag
tttgccgagaggtctgtggcaaagttggagaaaaccatcgatgacctagaagatgaagtc
tatgcccagaagatgaagtacaaggccattagcgaggaactggacaacgcactcaatgac
atcacctccctctga

DBGET integrated database retrieval system