KEGG   Homo sapiens (human): 7170Help
Entry
7170              CDS       T01001                                 

Gene name
TPM3, CAPM1, CFTD, HEL-189, HEL-S-82p, NEM1, OK/SW-cl.5, TM-5, TM3, TM30, TM30nm, TM5, TPMsk3, TRK, hscp30
Definition
tropomyosin 3
Orthology
K09290  
tropomyosin 3
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Pathways in cancer
Thyroid cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00032  
Thyroid cancer
H00698  
Nemaline myopathy
H00701  
Congenital fiber type disproportion (CFTD)
H00702  
Cap myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7170 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    7170 (TPM3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7170 (TPM3)
   05216 Thyroid cancer
    7170 (TPM3)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7170 (TPM3)
   05414 Dilated cardiomyopathy (DCM)
    7170 (TPM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.2
AA seq 248 aa AA seqDB search
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgatgcagaggagcgagctgagcgcctccagcgagaagttgagggagaaaggcgg
gcccgggaacaggctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaagagctggaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagct
gaaaaagctgctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttg
gaacgcacagaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggag
ctgaagaatgtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaa
aaagaagataaatatgaggaagaaatcaagattcttactgataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgacctg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
accctgcttgacctgaatgagatgtag

DBGET integrated database retrieval system