KEGG   Homo sapiens (human): 718Help
Entry
718               CDS       T01001                                 

Gene name
C3, AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p
Definition
complement component 3 (EC:3.4.21.43)
Orthology
K03990  
complement component 3
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Complement and coagulation cascades
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Staphylococcus aureus infection
Tuberculosis
Herpes simplex infection
Viral carcinogenesis
Systemic lupus erythematosus
Disease
H00102  
Classic complement pathway component defects
H00821  
Macular degeneration
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 1663 aa AA seqDB search
MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVH
DFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKV
VLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSL
SSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTE
KFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKT
PKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPL
SITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMD
RAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGA
SGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAEL
QCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEAC
KKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPESWLWNVEDLKE
PPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKE
DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTA
YVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKD
MALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLR
SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDA
KNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSD
RNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDE
YIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSY
IIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
NT seq 4992 nt NT seq  +upstreamnt  +downstreamnt
atgggacccacctcaggtcccagcctgctgctcctgctactaacccacctccccctggct
ctggggagtcccatgtactctatcatcacccccaacatcttgcggctggagagcgaggag
accatggtgctggaggcccacgacgcgcaaggggatgttccagtcactgttactgtccac
gacttcccaggcaaaaaactagtgctgtccagtgagaagactgtgctgacccctgccacc
aaccacatgggcaacgtcaccttcacgatcccagccaacagggagttcaagtcagaaaag
gggcgcaacaagttcgtgaccgtgcaggccaccttcgggacccaagtggtggagaaggtg
gtgctggtcagcctgcagagcgggtacctcttcatccagacagacaagaccatctacacc
cctggctccacagttctctatcggatcttcaccgtcaaccacaagctgctacccgtgggc
cggacggtcatggtcaacattgagaacccggaaggcatcccggtcaagcaggactccttg
tcttctcagaaccagcttggcgtcttgcccttgtcttgggacattccggaactcgtcaac
atgggccagtggaagatccgagcctactatgaaaactcaccacagcaggtcttctccact
gagtttgaggtgaaggagtacgtgctgcccagtttcgaggtcatagtggagcctacagag
aaattctactacatctataacgagaagggcctggaggtcaccatcaccgccaggttcctc
tacgggaagaaagtggagggaactgcctttgtcatcttcgggatccaggatggcgaacag
aggatttccctgcctgaatccctcaagcgcattccgattgaggatggctcgggggaggtt
gtgctgagccggaaggtactgctggacggggtgcagaacccccgagcagaagacctggtg
gggaagtctttgtacgtgtctgccaccgtcatcttgcactcaggcagtgacatggtgcag
gcagagcgcagcgggatccccatcgtgacctctccctaccagatccacttcaccaagaca
cccaagtacttcaaaccaggaatgccctttgacctcatggtgttcgtgacgaaccctgat
ggctctccagcctaccgagtccccgtggcagtccagggcgaggacactgtgcagtctcta
acccagggagatggcgtggccaaactcagcatcaacacacaccccagccagaagcccttg
agcatcacggtgcgcacgaagaagcaggagctctcggaggcagagcaggctaccaggacc
atgcaggctctgccctacagcaccgtgggcaactccaacaattacctgcatctctcagtg
ctacgtacagagctcagacccggggagaccctcaacgtcaacttcctcctgcgaatggac
cgcgcccacgaggccaagatccgctactacacctacctgatcatgaacaagggcaggctg
ttgaaggcgggacgccaggtgcgagagcccggccaggacctggtggtgctgcccctgtcc
atcaccaccgacttcatcccttccttccgcctggtggcgtactacacgctgatcggtgcc
agcggccagagggaggtggtggccgactccgtgtgggtggacgtcaaggactcctgcgtg
ggctcgctggtggtaaaaagcggccagtcagaagaccggcagcctgtacctgggcagcag
atgaccctgaagatagagggtgaccacggggcccgggtggtactggtggccgtggacaag
ggcgtgttcgtgctgaataagaagaacaaactgacgcagagtaagatctgggacgtggtg
gagaaggcagacatcggctgcaccccgggcagtgggaaggattacgccggtgtcttctcc
gacgcagggctgaccttcacgagcagcagtggccagcagaccgcccagagggcagaactt
cagtgcccgcagccagccgcccgccgacgccgttccgtgcagctcacggagaagcgaatg
gacaaagtcggcaagtaccccaaggagctgcgcaagtgctgcgaggacggcatgcgggag
aaccccatgaggttctcgtgccagcgccggacccgtttcatctccctgggcgaggcgtgc
aagaaggtcttcctggactgctgcaactacatcacagagctgcggcggcagcacgcgcgg
gccagccacctgggcctggccaggagtaacctggatgaggacatcattgcagaagagaac
atcgtttcccgaagtgagttcccagagagctggctgtggaacgttgaggacttgaaagag
ccaccgaaaaatggaatctctacgaagctcatgaatatatttttgaaagactccatcacc
acgtgggagattctggctgtgagcatgtcggacaagaaagggatctgtgtggcagacccc
ttcgaggtcacagtaatgcaggacttcttcatcgacctgcggctaccctactctgttgtt
cgaaacgagcaggtggaaatccgagccgttctctacaattaccggcagaaccaagagctc
aaggtgagggtggaactactccacaatccagccttctgcagcctggccaccaccaagagg
cgtcaccagcagaccgtaaccatcccccccaagtcctcgttgtccgttccatatgtcatc
gtgccgctaaagaccggcctgcaggaagtggaagtcaaggctgctgtctaccatcatttc
atcagtgacggtgtcaggaagtccctgaaggtcgtgccggaaggaatcagaatgaacaaa
actgtggctgttcgcaccctggatccagaacgcctgggccgtgaaggagtgcagaaagag
gacatcccacctgcagacctcagtgaccaagtcccggacaccgagtctgagaccagaatt
ctcctgcaagggaccccagtggcccagatgacagaggatgccgtcgacgcggaacggctg
aagcacctcattgtgaccccctcgggctgcggggaacagaacatgatcggcatgacgccc
acggtcatcgctgtgcattacctggatgaaacggagcagtgggagaagttcggcctagag
aagcggcagggggccttggagctcatcaagaaggggtacacccagcagctggccttcaga
caacccagctctgcctttgcggccttcgtgaaacgggcacccagcacctggctgaccgcc
tacgtggtcaaggtcttctctctggctgtcaacctcatcgccatcgactcccaagtcctc
tgcggggctgttaaatggctgatcctggagaagcagaagcccgacggggtcttccaggag
gatgcgcccgtgatacaccaagaaatgattggtggattacggaacaacaacgagaaagac
atggccctcacggcctttgttctcatctcgctgcaggaggctaaagatatttgcgaggag
caggtcaacagcctgccaggcagcatcactaaagcaggagacttccttgaagccaactac
atgaacctacagagatcctacactgtggccattgctggctatgctctggcccagatgggc
aggctgaaggggcctcttcttaacaaatttctgaccacagccaaagataagaaccgctgg
gaggaccctggtaagcagctctacaacgtggaggccacatcctatgccctcttggcccta
ctgcagctaaaagactttgactttgtgcctcccgtcgtgcgttggctcaatgaacagaga
tactacggtggtggctatggctctacccaggccaccttcatggtgttccaagccttggct
caataccaaaaggacgcccctgaccaccaggaactgaaccttgatgtgtccctccaactg
cccagccgcagctccaagatcacccaccgtatccactgggaatctgccagcctcctgcga
tcagaagagaccaaggaaaatgagggtttcacagtcacagctgaaggaaaaggccaaggc
accttgtcggtggtgacaatgtaccatgctaaggccaaagatcaactcacctgtaataaa
ttcgacctcaaggtcaccataaaaccagcaccggaaacagaaaagaggcctcaggatgcc
aagaacactatgatccttgagatctgtaccaggtaccggggagaccaggatgccactatg
tctatattggacatatccatgatgactggctttgctccagacacagatgacctgaagcag
ctggccaatggtgttgacagatacatctccaagtatgagctggacaaagccttctccgat
aggaacaccctcatcatctacctggacaaggtctcacactctgaggatgactgtctagct
ttcaaagttcaccaatactttaatgtagagcttatccagcctggagcagtcaaggtctac
gcctattacaacctggaggaaagctgtacccggttctaccatccggaaaaggaggatgga
aagctgaacaagctctgccgtgatgaactgtgccgctgtgctgaggagaattgcttcata
caaaagtcggatgacaaggtcaccctggaagaacggctggacaaggcctgtgagccagga
gtggactatgtgtacaagacccgactggtcaaggttcagctgtccaatgactttgacgag
tacatcatggccattgagcagaccatcaagtcaggctcggatgaggtgcaggttggacag
cagcgcacgttcatcagccccatcaagtgcagagaagccctgaagctggaggagaagaaa
cactacctcatgtggggtctctcctccgatttctggggagagaagcccaacctcagctac
atcatcgggaaggacacttgggtggagcactggcccgaggaggacgaatgccaagacgaa
gagaaccagaaacaatgccaggacctcggcgccttcaccgagagcatggttgtctttggg
tgccccaactga

DBGET integrated database retrieval system