KEGG   Homo sapiens (human): 7185Help
Entry
7185              CDS       T01001                                 

Gene name
TRAF1, EBI6, MGC:10353
Definition
(RefSeq) TNF receptor associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04668  TNF signaling pathway
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
N00123  Amplified REL to transcription
N00265  EBV LMP1 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7185 (TRAF1)
   04668 TNF signaling pathway
    7185 (TRAF1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    7185 (TRAF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7185 (TRAF1)
   05202 Transcriptional misregulation in cancers
    7185 (TRAF1)
   05203 Viral carcinogenesis
    7185 (TRAF1)
   05222 Small cell lung cancer
    7185 (TRAF1)
  Infectious diseases
   05168 Herpes simplex infection
    7185 (TRAF1)
   05169 Epstein-Barr virus infection
    7185 (TRAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd Not3
Motif
Other DBs
NCBI-GeneID: 7185
NCBI-ProteinID: NP_001177874
OMIM: 601711
HGNC: 12031
Ensembl: ENSG00000056558
Vega: OTTHUMG00000020578
Pharos: Q13077(Tbio)
UniProt: Q13077
Structure
PDB: 

Jmol
Position
9q33.2
AA seq 416 aa AA seqDB search
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagctcaggcagcagtcctcgcccggcccctgatgagaatgagtttcccttt
gggtgccctcccaccgtctgccaggacccaaaggagcccagggctctctgctgtgcaggc
tgtctctctgagaacccgaggaatggcgaggatcagatctgccccaaatgcagaggggaa
gacctccagtctataagcccaggaagccgtcttcgaactcaggagaaggctcaccccgag
gtggctgaggctggaattgggtgcccctttgcaggtgtcggctgctccttcaagggaagc
ccacagtctgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgttg
gggttcatgaaacagtggaaggcccggctgggctgtggcctggagtctgggcccatggcc
ctggagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgggggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaggggaagctgcgtgtgtttgagaacatt
gttgctgtcctcaacaaggaggtggaggcctcccacctggccctggccacctctatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagcttcag
cagaccctggcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcactttcctgtggaagatcaccaatgtcaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactgccaag
tatggctacaagttgtgcctgcggctgtacctgaatggagatggcactggaaagagaacc
catctgtcgctcttcatcgtgatcatgagaggggagtatgatgcgctgctgccgtggccc
ttccggaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgac
gccttccggcctgacctaagctcagcgtccttccagaggccccagagtgaaaccaacgtg
gccagtggatgcccactcttcttccccctcagcaaactgcagtcacccaagcacgcctac
gtgaaggacgacacaatgttcctcaagtgcattgtggagaccagcacttag

DBGET integrated database retrieval system