KEGG   Homo sapiens (human): 7185Help
Entry
7185              CDS       T01001                                 

Gene name
TRAF1, EBI6, MGC:10353
Definition
TNF receptor-associated factor 1
Orthology
K03172  
TNF receptor-associated factor 1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
TNF signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7185 (TRAF1)
   04668 TNF signaling pathway
    7185 (TRAF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7185 (TRAF1)
   05202 Transcriptional misregulation in cancers
    7185 (TRAF1)
   05203 Viral carcinogenesis
    7185 (TRAF1)
   05222 Small cell lung cancer
    7185 (TRAF1)
  Infectious diseases
   05168 Herpes simplex infection
    7185 (TRAF1)
   05169 Epstein-Barr virus infection
    7185 (TRAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33-q34
AA seq 416 aa AA seqDB search
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagctcaggcagcagtcctcgcccggcccctgatgagaatgagtttcccttt
gggtgccctcccaccgtctgccaggacccaaaggagcccagggctctctgctgtgcaggc
tgtctctctgagaacccgaggaatggcgaggatcagatctgccccaaatgcagaggggaa
gacctccagtctataagcccaggaagccgtcttcgaactcaggagaaggctcaccccgag
gtggctgaggctggaattgggtgcccctttgcaggtgtcggctgctccttcaagggaagc
ccacagtctgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgttg
gggttcatgaaacagtggaaggcccggctgggctgtggcctggagtctgggcccatggcc
ctggagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgggggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaggggaagctgcgtgtgtttgagaacatt
gttgctgtcctcaacaaggaggtggaggcctcccacctggccctggccacctctatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagcttcag
cagaccctggcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcactttcctgtggaagatcaccaatgtcaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactgccaag
tatggctacaagttgtgcctgcggctgtacctgaatggagatggcactggaaagagaacc
catctgtcgctcttcatcgtgatcatgagaggggagtatgatgcgctgctgccgtggccc
ttccggaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgac
gccttccggcctgacctaagctcagcgtccttccagaggccccagagtgaaaccaacgtg
gccagtggatgcccactcttcttccccctcagcaaactgcagtcacccaagcacgcctac
gtgaaggacgacacaatgttcctcaagtgcattgtggagaccagcacttag

DBGET integrated database retrieval system