KEGG   Homo sapiens (human): 7185Help
Entry
7185              CDS       T01001                                 

Gene name
TRAF1, EBI6, MGC:10353
Definition
TNF receptor-associated factor 1
Orthology
K03172  
TNF receptor-associated factor 1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
TNF signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33-q34
AA seq 416 aa AA seqDB search
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagctcaggcagcagtcctcgcccggcccctgatgagaatgagtttcccttt
gggtgccctcccaccgtctgccaggacccaaaggagcccagggctctctgctgtgcaggc
tgtctctctgagaacccgaggaatggcgaggatcagatctgccccaaatgcagaggggaa
gacctccagtctataagcccaggaagccgtcttcgaactcaggagaaggctcaccccgag
gtggctgaggctggaattgggtgcccctttgcaggtgtcggctgctccttcaagggaagc
ccacagtctgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgttg
gggttcatgaaacagtggaaggcccggctgggctgtggcctggagtctgggcccatggcc
ctggagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgggggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaggggaagctgcgtgtgtttgagaacatt
gttgctgtcctcaacaaggaggtggaggcctcccacctggccctggccacctctatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagcttcag
cagaccctggcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcactttcctgtggaagatcaccaatgtcaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactgccaag
tatggctacaagttgtgcctgcggctgtacctgaatggagatggcactggaaagagaacc
catctgtcgctcttcatcgtgatcatgagaggggagtatgatgcgctgctgccgtggccc
ttccggaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgac
gccttccggcctgacctaagctcagcgtccttccagaggccccagagtgaaaccaacgtg
gccagtggatgcccactcttcttccccctcagcaaactgcagtcacccaagcacgcctac
gtgaaggacgacacaatgttcctcaagtgcattgtggagaccagcacttag

DBGET integrated database retrieval system