KEGG   Homo sapiens (human): 72Help
Entry
72                CDS       T01001                                 

Gene name
ACTG2, ACT, ACTA3, ACTE, ACTL3, ACTSG, VSCM
Definition
(RefSeq) actin, gamma 2, smooth muscle, enteric
  KO
K12315  
actin, gamma-enteric smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    72 (ACTG2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     72 (ACTG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   72 (ACTG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.1
AA seq 376 aa AA seqDB search
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaggagaccaccgcgctcgtgtgtgacaatggctctggcctgtgcaaggca
ggcttcgcaggagatgatgccccccgggctgtcttcccctccattgtgggccgccctcgc
caccagggtgtgatggtgggaatgggccagaaagacagctatgtgggggatgaggctcag
agcaagcgagggatcctaactctcaaataccccattgaacacggcatcatcaccaactgg
gatgacatggagaagatctggcaccactccttctacaatgagctgcgtgtagcacctgaa
gagcaccccaccctgctcacagaggctcccctaaatcccaaggccaacagggaaaagatg
acccagatcatgtttgaaaccttcaatgtccctgccatgtacgtcgccattcaagctgtg
ctctccctctatgcctctggccgcacgacaggcatcgtcctggattcaggtgatggcgtc
acccacaatgtccccatctatgaaggctatgccctgccccatgccatcatgcgcctggac
ttggctggccgtgacctcacggactacctcatgaagatcctcacagagagaggctattcc
tttgtgaccacagctgagagagaaattgtgcgagacatcaaggagaagctgtgctatgtg
gccctggattttgagaatgagatggccacagcagcttcctcttcctccctggagaagagc
tatgagctgccagatgggcaggttatcaccattggcaatgagcgcttccgctgccctgag
accctcttccagccttcctttattggcatggagtccgctggaattcatgagacaacctac
aattccatcatgaagtgtgacattgacatccgtaaggacttatatgccaacaatgtcctc
tctgggggcaccaccatgtaccctggcattgctgacaggatgcagaaggagatcacagcc
ctggcccccagcaccatgaagatcaagattattgctcccccagagcggaagtactcagtc
tggatcgggggctctatcctggcctctctctccaccttccagcagatgtggatcagcaag
cctgagtatgatgaggcagggccctccattgtccacaggaagtgcttctaa

DBGET integrated database retrieval system