KEGG   Homo sapiens (human): 72Help
Entry
72                CDS       T01001                                 

Gene name
ACTG2, ACT, ACTA3, ACTE, ACTL3, ACTSG
Definition
actin, gamma 2, smooth muscle, enteric
Orthology
K12315  
actin, gamma-enteric smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Class
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.1
AA seq 333 aa AA seqDB search
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQIWHHSFYNELRVAPEEHP
TLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHN
VPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALD
FENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSI
MKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIG
GSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaggagaccaccgcgctcgtgtgtgacaatggctctggcctgtgcaaggca
ggcttcgcaggagatgatgccccccgggctgtcttcccctccattgtgggccgccctcgc
caccagatctggcaccactccttctacaatgagctgcgtgtagcacctgaagagcacccc
accctgctcacagaggctcccctaaatcccaaggccaacagggaaaagatgacccagatc
atgtttgaaaccttcaatgtccctgccatgtacgtcgccattcaagctgtgctctccctc
tatgcctctggccgcacgacaggcatcgtcctggattcaggtgatggcgtcacccacaat
gtccccatctatgaaggctatgccctgccccatgccatcatgcgcctggacttggctggc
cgtgacctcacggactacctcatgaagatcctcacagagagaggctattcctttgtgacc
acagctgagagagaaattgtgcgagacatcaaggagaagctgtgctatgtggccctggat
tttgagaatgagatggccacagcagcttcctcttcctccctggagaagagctatgagctg
ccagatgggcaggttatcaccattggcaatgagcgcttccgctgccctgagaccctcttc
cagccttcctttattggcatggagtccgctggaattcatgagacaacctacaattccatc
atgaagtgtgacattgacatccgtaaggacttatatgccaacaatgtcctctctgggggc
accaccatgtaccctggcattgctgacaggatgcagaaggagatcacagccctggccccc
agcaccatgaagatcaagattattgctcccccagagcggaagtactcagtctggatcggg
ggctctatcctggcctctctctccaccttccagcagatgtggatcagcaagcctgagtat
gatgaggcagggccctccattgtccacaggaagtgcttctaa

DBGET integrated database retrieval system