KEGG   Homo sapiens (human): 720Help
Entry
720               CDS       T01001                                 

Gene name
C4A, C4, C4A2, C4A3, C4A4, C4A6, C4AD, C4S, CO4, CPAMD2, RG
Definition
(RefSeq) complement component 4A (Rodgers blood group)
  KO
K03989  
complement component 4
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Pertussis
Staphylococcus aureus infection
Systemic lupus erythematosus
Disease
H00080  
Systemic lupus erythematosus
H00102  
Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    720 (C4A)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    720 (C4A)
  Infectious diseases
   05133 Pertussis
    720 (C4A)
   05150 Staphylococcus aureus infection
    720 (C4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   720 (C4A)
  Exosomal proteins of other cancer cells
   720 (C4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 1744 aa AA seqDB search
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYAL
TLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctctgggggctgatctgggcatccagcttcttcaccttatctctgcagaag
cccaggttgctcttgttctctccttctgtggttcatctgggggtccccctatcggtgggg
gtgcagctccaggatgtgccccgaggacaggtagtgaaaggatcagtgttcctgagaaac
ccatctcgtaataatgtcccctgctccccaaaggtggacttcacccttagctcagaaaga
gacttcgcactcctcagtctccaggtgcccttgaaagatgcgaagagctgtggcctccat
caactcctcagaggccctgaggtccagctggtggcccattcgccatggctaaaggactct
ctgtccagaacgacaaacatccagggtatcaacctgctcttctcctctcgccgggggcac
ctctttttgcagacggaccagcccatttacaaccctggccagcgggttcggtaccgggtc
tttgctctggatcagaagatgcgcccgagcactgacaccatcacagtcatggtggagaac
tctcacggcctccgcgtgcggaagaaggaggtgtacatgccctcgtccatcttccaggat
gactttgtgatcccagacatctcagagccagggacctggaagatctcagcccgattctca
gatggcctggaatccaacagcagcacccagtttgaggtgaagaaatatgtccttcccaac
tttgaggtgaagatcacccctggaaagccctacatcctgacggtgccaggccatcttgat
gaaatgcagttagacatccaggccaggtacatctatgggaagccagtgcagggggtggca
tatgtgcgctttgggctcctagatgaggatggtaagaagactttctttcgggggctggag
agtcagaccaagctggtgaatggacagagccacatttccctctcaaaggcagagttccag
gacgccctggagaagctgaatatgggcattactgacctccaggggctgcgcctctacgtt
gctgcagccatcattgagtctccaggtggggagatggaggaggcagagctcacatcctgg
tattttgtgtcatctcccttctccttggatcttagcaagaccaagcgacaccttgtgcct
ggggcccccttcctgctgcaggccttggtccgtgagatgtcaggctccccagcttctggc
attcctgtcaaagtttctgccacggtgtcttctcctgggtctgttcctgaagtccaggac
attcagcaaaacacagacgggagcggccaagtcagcattccaataattatccctcagacc
atctcagagctgcagctctcagtatctgcaggctccccacatccagcgatagccaggctc
actgtggcagccccaccttcaggaggccccgggtttctgtctattgagcggccggattct
cgacctcctcgtgttggggacactctgaacctgaacttgcgagccgtgggcagtggggcc
accttttctcattactactacatgatcctatcccgagggcagatcgtgttcatgaatcga
gagcccaagaggaccctgacctcggtctcggtgtttgtggaccatcacctggcaccctcc
ttctactttgtggccttctactaccatggagaccacccagtggccaactccctgcgagtg
gatgtccaggctggggcctgcgagggcaagctggagctcagcgtggacggtgccaagcag
taccggaacggggagtccgtgaagctccacttagaaaccgactccctagccctggtggcg
ctgggagccttggacacagctctgtatgctgcaggcagcaagtcccacaagcccctcaac
atgggcaaggtctttgaagctatgaacagctatgacctcggctgtggtcctgggggtggg
gacagtgcccttcaggtgttccaggcagcgggcctggccttttctgatggagaccagtgg
accttatccagaaagagactaagctgtcccaaggagaagacaacccggaaaaagagaaac
gtgaacttccaaaaggcgattaatgagaaattgggtcagtatgcttccccgacagccaag
cgctgctgccaggatggggtgacacgtctgcccatgatgcgttcctgcgagcagcgggca
gcccgcgtgcagcagccggactgccgggagcccttcctgtcctgctgccaatttgctgag
agtctgcgcaagaagagcagggacaagggccaggcgggcctccaacgagccctggagatc
ctgcaggaggaggacctgattgatgaggatgacattcccgtgcgcagcttcttcccagag
aactggctctggagagtggaaacagtggaccgctttcaaatattgacactgtggctcccc
gactctctgaccacgtgggagatccatggcctgagcctgtccaaaaccaaaggcctatgt
gtggccaccccagtccagctccgggtgttccgcgagttccacctgcacctccgcctgccc
atgtctgtccgccgctttgagcagctggagctgcggcctgtcctctataactacctggat
aaaaacctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggctgggggc
ggagggctggcccagcaggtgctggtgcctgcgggctctgcccggcctgttgccttctct
gtggtgcccacggcagccgccgctgtgtctctgaaggtggtggctcgagggtccttcgaa
ttccctgtgggagatgcggtgtccaaggttctgcagattgagaaggaaggggccatccat
agagaggagctggtctatgaactcaaccccttggaccaccgaggccggaccttggaaata
cctggcaactctgatcccaatatgatccctgatggggactttaacagctacgtcagggtt
acagcctcagatccattggacactttaggctctgagggggccttgtcaccaggaggcgtg
gcctccctcttgaggcttcctcgaggctgtggggagcaaaccatgatctacttggctccg
acactggctgcttcccgctacctggacaagacagagcagtggagcacactgcctcccgag
accaaggaccacgccgtggatctgatccagaaaggctacatgcggatccagcagtttcgg
aaggcggatggttcctatgcggcttggttgtcacgggacagcagcacctggctcacagcc
tttgtgttgaaggtcctgagtttggcccaggagcaggtaggaggctcgcctgagaaactg
caggagacatctaactggcttctgtcccagcagcaggctgacggctcgttccaggacccc
tgtccagtgttagacaggagcatgcaggggggtttggtgggcaatgatgagactgtggca
ctcacagcctttgtgaccatcgcccttcatcatgggctggccgtcttccaggatgagggt
gcagagccattgaagcagagagtggaagcctccatctcaaaggcaaactcatttttgggg
gagaaagcaagtgctgggctcctgggtgcccacgcagctgccatcacggcctatgccctg
acactgaccaaggcgcctgtggacctgctcggtgttgcccacaacaacctcatggcaatg
gcccaggagactggagataacctgtactggggctcagtcactggttctcagagcaatgcc
gtgtcgcccaccccggctcctcgcaacccatccgaccccatgccccaggccccagccctg
tggattgaaaccacagcctacgccctgctgcacctcctgcttcacgagggcaaagcagag
atggcagaccaggcttcggcctggctcacccgtcagggcagcttccaagggggattccgc
agtacccaagacacggtgattgccctggatgccctgtctgcctactggattgcctcccac
accactgaggagaggggtctcaatgtgactctcagctccacaggccggaatgggttcaag
tcccacgcgctgcagctgaacaaccgccagattcgcggcctggaggaggagctgcagttt
tccttgggcagcaagatcaatgtgaaggtgggaggaaacagcaaaggaaccctgaaggtc
cttcgtacctacaatgtcctggacatgaagaacacgacctgccaggacctacagatagaa
gtgacagtcaaaggccacgtcgagtacacgatggaagcaaacgaggactatgaggactat
gagtacgatgagcttccagccaaggatgacccagatgcccctctgcagcccgtgacaccc
ctgcagctgtttgagggtcggaggaaccgccgcaggagggaggcgcccaaggtggtggag
gagcaggagtccagggtgcactacaccgtgtgcatctggcggaacggcaaggtggggctg
tctggcatggccatcgcggacgtcaccctcctgagtggattccacgccctgcgtgctgac
ctggagaagctgacctccctctctgaccgttacgtgagtcactttgagaccgaggggccc
cacgtcctgctgtattttgactcggtccccacctcccgggagtgcgtgggctttgaggct
gtgcaggaagtgccggtggggctggtgcagccggccagcgcaaccctgtacgactactac
aaccccgagcgcagatgttctgtgttttacggggcaccaagtaagagcagactcttggcc
accttgtgttctgctgaagtctgccagtgtgctgaggggaagtgccctcgccagcgtcgc
gccctggagcggggtctgcaggacgaggatggctacaggatgaagtttgcctgctactac
ccccgtgtggagtacggcttccaggttaaggttctccgagaagacagcagagctgctttc
cgcctctttgagaccaagatcacccaagtcctgcacttcaccaaggatgtcaaggccgct
gctaatcagatgcgcaacttcctggttcgagcctcctgccgccttcgcttggaacctggg
aaagaatatttgatcatgggtctggatggggccacctatgacctcgagggacacccccag
tacctgctggactcgaatagctggatcgaggagatgccctctgaacgcctgtgccggagc
acccgccagcgggcagcctgtgcccagctcaacgacttcctccaggagtatggcactcag
gggtgccaggtgtga

DBGET integrated database retrieval system