KEGG   Homo sapiens (human): 7220Help
Entry
7220              CDS       T01001                                 

Gene name
TRPC1, HTRP-1, TRP1
Definition
transient receptor potential cation channel, subfamily C, member 1
Orthology
K04964  
transient receptor potential cation channel subfamily C member 1
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Serotonergic synapse
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    7220 (TRPC1)
  Nervous system
   04724 Glutamatergic synapse
    7220 (TRPC1)
   04726 Serotonergic synapse
    7220 (TRPC1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   7220 (TRPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q23
AA seq 793 aa AA seqDB search
MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDS
EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK
QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL
LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF
WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF
HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF
LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS
LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW
KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW
RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG
FRTSKYAMFYPRN
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctcgggcgcctcctcctcctccctgcct
tcctctccatcctcttcctcgccgaacgaggtgatggcgctgaaggatgtgcgggaggtg
aaggaggagaatacgctgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaaacttggatatactg
cagcttcttttggactacggttgtcagtctgcagatgcacttttggtggcaatcgactct
gaagtagtgggagctgttgatatactacttaatcatcgaccaaaacgatcatcaagacca
actatagtaaaactaatggaacgaattcagaatcctgagtattcaacaactatggatgtt
gcacctgtcattttagctgctcatcgtaacaactatgaaattcttacaatgctcttaaaa
caggatgtatctctacccaagccccatgcagttggctgtgaatgcacattgtgttctgca
aaaaacaaaaaggatagcctccggcattccaggtttcgtcttgatatatatcgatgtttg
gccagtccagctctaataatgttaacagaggaggatccaattctgagagcatttgaactt
agtgctgatttaaaagaactaagtcttgtggaggtggaattcaggaatgattatgaggaa
ctagcccggcaatgtaaaatgtttgctaaggatttacttgcacaagcccggaattctcgt
gaattggaagttattctaaaccatacgtctagtgacgagcctcttgacaaacggggatta
ttagaagaaagaatgaatttaagtcgtctaaaacttgctatcaaatataaccagaaagag
tttgtctcccagtctaactgccagcagttcctgaacactgtttggtttggacagatgtcg
ggttaccgacgcaagcccacctgtaagaagataatgactgttttgacagtaggcatcttt
tggccagttttgtcactttgttatttgatagctcccaaatctcagtttggcagaatcatt
cacacaccttttatgaaatttatcattcatggagcatcatatttcacatttctgctgttg
cttaatctatactctcttgtctacaatgaggataagaaaaacacaatggggccagccctt
gaaagaatagactatcttcttattctgtggattattgggatgatttggtcagacattaaa
agactctggtatgaagggttggaagactttttagaagaatctcgtaatcaactcagtttt
gtcatgaattctctttatttggcaacctttgccctcaaagtggttgctcacaacaagttt
catgattttgctgatcggaaggattgggatgcattccatcctacactggtggcagaaggg
ctttttgcatttgcaaatgttctaagttatcttcgtctcttttttatgtatacaaccagc
tctatcttgggtccattacagatttcaatgggacagatgttacaagattttggaaaattt
cttgggatgtttcttcttgttttgttttctttcacaattggactgacacaactgtatgat
aaaggatatacttcaaaggagcagaaggactgtgtaggcatcttctgtgaacagcaaagc
aatgataccttccattcgttcattggcacctgctttgctttgttctggtatattttctcc
ttagcgcatgtggcaatctttgtcacaagatttagctatggagaagaactgcagtccttt
gtgggagctgtcattgttggtacatacaatgtcgtggttgtgattgtgcttaccaaactg
ctggtggcaatgcttcataaaagctttcagttgatagcaaatcatgaagacaaagaatgg
aagtttgctcgagcaaaattatggcttagctactttgatgacaaatgtacgttacctcca
cctttcaacatcattccctcaccaaagactatctgctatatgattagtagcctcagtaag
tggatttgctctcatacatcaaaaggcaaggtcaaacggcaaaacagtttaaaggaatgg
aggaatttgaaacagaagagagatgaaaactatcaaaaagtgatgtgctgcctagtgcat
cgttacttgacttccatgagacagaagatgcaaagtacagatcaggcaactgtggaaaat
ctaaacgaactgcgccaagatctgtcaaaattccgaaatgaaataagggatttacttggc
tttcggacttctaaatatgctatgttttatccaagaaattaa

DBGET integrated database retrieval system