KEGG   Homo sapiens (human): 7251Help
Entry
7251              CDS       T01001                                 

Gene name
TSG101, TSG10, VPS23
Definition
tumor susceptibility 101
Orthology
K12183  
ESCRT-I complex subunit TSG101
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-I complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7251 (TSG101)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7251 (TSG101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15
AA seq 390 aa AA seqDB search
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP
NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW
RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS
ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL
KHVRLLSRKQFQLRALMQKARKTAGLSDLY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcggagagccagctcaagaaaatggtgtccaagtacaaatacagagaccta
actgtacgtgaaactgtcaatgttattactctatacaaagatctcaaacctgttttggat
tcatatgtttttaacgatggcagttccagggaactaatgaacctcactggaacaatccct
gtgccttatagaggtaatacatacaatattccaatatgcctatggctactggacacatac
ccatataatccccctatctgttttgttaagcctactagttcaatgactattaaaacagga
aagcatgttgatgcaaatgggaagatatatcttccttatctacatgaatggaaacaccca
cagtcagacttgttggggcttattcaggtcatgattgtggtatttggagatgaacctcca
gtcttctctcgtcctatttcggcatcctatccgccataccaggcaacggggccaccaaat
acttcctacatgccaggcatgccaggtggaatctctccatacccatccggataccctccc
aatcccagtggttacccaggctgtccttacccacctggtggtccatatcctgccacaaca
agttctcagtacccttctcagcctcctgtgaccactgttggtcccagtagggatggcaca
atcagcgaggacaccatccgagcctctctcatctctgcggtcagtgacaaactgagatgg
cggatgaaggaggaaatggatcgtgcccaggcagagctcaatgccttgaaacgaacagaa
gaagacctgaaaaagggtcaccagaaactggaagagatggttacccgtttagatcaagaa
gtagccgaggttgataaaaacatagaacttttgaaaaagaaggatgaagaactcagttct
gctctggaaaaaatggaaaatcagtctgaaaacaatgatatcgatgaagttatcattccc
acagctcccttatacaaacagatcctgaatctgtatgcagaagaaaacgctattgaagac
actatcttttacttgggagaagccttgagaaggggcgtgatagacctggatgtcttcctg
aagcatgtacgtcttctgtcccgtaaacagttccagctgagggcactaatgcaaaaagca
agaaagactgccggtctcagtgacctctactga

DBGET integrated database retrieval system