KEGG   Homo sapiens (human): 727Help
Entry
727               CDS       T01001                                 

Gene name
C5, C5D, C5a, C5b, CPAMD4, ECLZB
Definition
complement component 5
Orthology
K03994  
complement component 5
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Prion diseases
Pertussis
Staphylococcus aureus infection
Herpes simplex infection
Systemic lupus erythematosus
Disease
H00103  
Late complement pathway defects
Drug target
Eculizumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    727 (C5)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    727 (C5)
  Neurodegenerative diseases
   05020 Prion diseases
    727 (C5)
  Infectious diseases
   05133 Pertussis
    727 (C5)
   05150 Staphylococcus aureus infection
    727 (C5)
   05168 Herpes simplex infection
    727 (C5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33-q34
AA seq 1676 aa AA seqDB search
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atgggccttttgggaatactttgttttttaatcttcctggggaaaacctggggacaggag
caaacatatgtcatttcagcaccaaaaatattccgtgttggagcatctgaaaatattgtg
attcaagtttatggatacactgaagcatttgatgcaacaatctctattaaaagttatcct
gataaaaaatttagttactcctcaggccatgttcatttatcctcagagaataaattccaa
aactctgcaatcttaacaatacaaccaaaacaattgcctggaggacaaaacccagtttct
tatgtgtatttggaagttgtatcaaagcatttttcaaaatcaaaaagaatgccaataacc
tatgacaatggatttctcttcattcatacagacaaacctgtttatactccagaccagtca
gtaaaagttagagtttattcgttgaatgacgacttgaagccagccaaaagagaaactgtc
ttaactttcatagatcctgaaggatcagaagttgacatggtagaagaaattgatcatatt
ggaattatctcttttcctgacttcaagattccgtctaatcctagatatggtatgtggacg
atcaaggctaaatataaagaggacttttcaacaactggaaccgcatattttgaagttaaa
gaatatgtcttgccacatttttctgtctcaatcgagccagaatataatttcattggttac
aagaactttaagaattttgaaattactataaaagcaagatatttttataataaagtagtc
actgaggctgacgtttatatcacatttggaataagagaagacttaaaagatgatcaaaaa
gaaatgatgcaaacagcaatgcaaaacacaatgttgataaatggaattgctcaagtcaca
tttgattctgaaacagcagtcaaagaactgtcatactacagtttagaagatttaaacaac
aagtacctttatattgctgtaacagtcatagagtctacaggtggattttctgaagaggca
gaaatacctggcatcaaatatgtcctctctccctacaaactgaatttggttgctactcct
cttttcctgaagcctgggattccatatcccatcaaggtgcaggttaaagattcgcttgac
cagttggtaggaggagtcccagtaacactgaatgcacaaacaattgatgtaaaccaagag
acatctgacttggatccaagcaaaagtgtaacacgtgttgatgatggagtagcttccttt
gtgcttaatctcccatctggagtgacggtgctggagtttaatgtcaaaactgatgctcca
gatcttccagaagaaaatcaggccagggaaggttaccgagcaatagcatactcatctctc
agccaaagttacctttatattgattggactgataaccataaggctttgctagtgggagaa
catctgaatattattgttacccccaaaagcccatatattgacaaaataactcactataat
tacttgattttatccaagggcaaaattatccactttggcacgagggagaaattttcagat
gcatcttatcaaagtataaacattccagtaacacagaacatggttccttcatcccgactt
ctggtctattacatcgtcacaggagaacagacagcagaattagtgtctgattcagtctgg
ttaaatattgaagaaaaatgtggcaaccagctccaggttcatctgtctcctgatgcagat
gcatattctccaggccaaactgtgtctcttaatatggcaactggaatggattcctgggtg
gcattagcagcagtggacagtgctgtgtatggagtccaaagaggagccaaaaagcccttg
gaaagagtatttcaattcttagagaagagtgatctgggctgtggggcaggtggtggcctc
aacaatgccaatgtgttccacctagctggacttaccttcctcactaatgcaaatgcagat
gactcccaagaaaatgatgaaccttgtaaagaaattctcaggccaagaagaacgctgcaa
aagaagatagaagaaatagctgctaaatataaacattcagtagtgaagaaatgttgttac
gatggagcctgcgttaataatgatgaaacctgtgagcagcgagctgcacggattagttta
gggccaagatgcatcaaagctttcactgaatgttgtgtcgtcgcaagccagctccgtgct
aatatctctcataaagacatgcaattgggaaggctacacatgaagaccctgttaccagta
agcaagccagaaattcggagttattttccagaaagctggttgtgggaagttcatcttgtt
cccagaagaaaacagttgcagtttgccctacctgattctctaaccacctgggaaattcaa
ggcgttggcatttcaaacactggtatatgtgttgctgatactgtcaaggcaaaggtgttc
aaagatgtcttcctggaaatgaatataccatattctgttgtacgaggagaacagatccaa
ttgaaaggaactgtttacaactataggacttctgggatgcagttctgtgttaaaatgtct
gctgtggagggaatctgcacttcggaaagcccagtcattgatcatcagggcacaaagtcc
tccaaatgtgtgcgccagaaagtagagggctcctccagtcacttggtgacattcactgtg
cttcctctggaaattggccttcacaacatcaatttttcactggagacttggtttggaaaa
gaaatcttagtaaaaacattacgagtggtgccagaaggtgtcaaaagggaaagctattct
ggtgttactttggatcctaggggtatttatggtaccattagcagacgaaaggagttccca
tacaggatacccttagatttggtccccaaaacagaaatcaaaaggattttgagtgtaaaa
ggactgcttgtaggtgagatcttgtctgcagttctaagtcaggaaggcatcaatatccta
acccacctccccaaagggagtgcagaggcggagctgatgagcgttgtcccagtattctat
gtttttcactacctggaaacaggaaatcattggaacatttttcattctgacccattaatt
gaaaagcagaaactgaagaaaaaattaaaagaagggatgttgagcattatgtcctacaga
aatgctgactactcttacagtgtgtggaagggtggaagtgctagcacttggttaacagct
tttgctttaagagtacttggacaagtaaataaatacgtagagcagaaccaaaattcaatt
tgtaattctttattgtggctagttgagaattatcaattagataatggatctttcaaggaa
aattcacagtatcaaccaataaaattacagggtaccttgcctgttgaagcccgagagaac
agcttatatcttacagcctttactgtgattggaattagaaaggctttcgatatatgcccc
ctggtgaaaatcgacacagctctaattaaagctgacaactttctgcttgaaaatacactg
ccagcccagagcacctttacattggccatttctgcgtatgctctttccctgggagataaa
actcacccacagtttcgttcaattgtttcagctttgaagagagaagctttggttaaaggt
aatccacccatttatcgtttttggaaagacaatcttcagcataaagacagctctgtacct
aacactggtacggcacgtatggtagaaacaactgcctatgctttactcaccagtctgaac
ttgaaagatataaattatgttaacccagtcatcaaatggctatcagaagagcagaggtat
ggaggtggcttttattcaacccaggacacaatcaatgccattgagggcctgacggaatat
tcactcctggttaaacaactccgcttgagtatggacatcgatgtttcttacaagcataaa
ggtgccttacataattataaaatgacagacaagaatttccttgggaggccagtagaggtg
cttctcaatgatgacctcattgtcagtacaggatttggcagtggcttggctacagtacat
gtaacaactgtagttcacaaaaccagtacctctgaggaagtttgcagcttttatttgaaa
atcgatactcaggatattgaagcatcccactacagaggctacggaaactctgattacaaa
cgcatagtagcatgtgccagctacaagcccagcagggaagaatcatcatctggatcctct
catgcggtgatggacatctccttgcctactggaatcagtgcaaatgaagaagacttaaaa
gcccttgtggaaggggtggatcaactattcactgattaccaaatcaaagatggacatgtt
attctgcaactgaattcgattccctccagtgatttcctttgtgtacgattccggatattt
gaactctttgaagttgggtttctcagtcctgccactttcacagtgtacgaataccacaga
ccagataaacagtgtaccatgttttatagcacttccaatatcaaaattcagaaagtctgt
gaaggagccgcgtgcaagtgtgtagaagctgattgtgggcaaatgcaggaagaattggat
ctgacaatctctgcagagacaagaaaacaaacagcatgtaaaccagagattgcatatgct
tataaagttagcatcacatccatcactgtagaaaatgtttttgtcaagtacaaggcaacc
cttctggatatctacaaaactggggaagctgttgctgagaaagactctgagattaccttc
attaaaaaggtaacctgtactaacgctgagctggtaaaaggaagacagtacttaattatg
ggtaaagaagccctccagataaaatacaatttcagtttcaggtacatctaccctttagat
tccttgacctggattgaatactggcctagagacacaacatgttcatcgtgtcaagcattt
ttagctaatttagatgaatttgccgaagatatctttttaaatggatgctaa

DBGET integrated database retrieval system