KEGG   Homo sapiens (human): 7277Help
Entry
7277              CDS       T01001                                 

Gene name
TUBA4A, H2-ALPHA, TUBA1
Definition
tubulin, alpha 4a
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7277 (TUBA4A)
  Cell communication
   04540 Gap junction
    7277 (TUBA4A)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7277 (TUBA4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7277 (TUBA4A)
  Exosomal proteins of other body fluids (saliva and urine)
   7277 (TUBA4A)
  Exosomal proteins of colorectal cancer cells
   7277 (TUBA4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 433 aa AA seqDB search
MGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVI
DEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGF
LVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTL
EHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEF
QTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMAC
CLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV
CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEV
GIDSYEDEDEGEE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcctgctgggagctctattgcttggaacatgggattcagcctgatgggcag
atgcccagtgacaagaccattggtggaggggacgactccttcaccaccttcttctgtgaa
actggtgctggaaaacacgtaccccgggcagtttttgtggatctggagcctacggtcatt
gatgagatccgaaatggcccataccgacagctcttccacccagagcagctcatcactggg
aaagaggatgctgccaacaactatgcccgtggtcactataccattggcaaggagatcatt
gacccagtgctggatcggatccgcaagctgtctgaccagtgcacaggacttcagggcttc
ctggtgttccacagctttggtgggggcactggctctggcttcacctcactcctgatggag
cggctctctgttgactatggcaagaaatccaagctggaattctccatctacccagccccc
caggtgtctacagccgtggtcgagccctacaactctatcctgaccacccacaccaccctg
gagcactcagactgtgccttcatggtggacaacgaagcaatctatgacatctgccgccgc
aacctagacatcgagcgcccaacctacaccaacctcaatcgcctcattagccaaattgtc
tcctccatcacagcttctctgcgctttgacggggccctcaatgtggacctgacagagttc
cagaccaacctggtgccctaccctcgcatccacttccccctggccacctatgcaccagtc
atctctgcagaaaaggcataccacgagcagctgtcggtggcagagatcaccaatgcctgc
tttgagcctgccaaccagatggtaaagtgtgatccccggcacggcaagtacatggcctgc
tgcctgctgtaccgtggagatgtggtgcccaaggatgtcaacgctgccattgccgccatc
aagaccaagcgcagcattcagtttgtggactggtgccccacaggcttcaaggttggtatc
aactaccagcctcccactgtggtgcctgggggtgacctggccaaggtgcagcgtgccgtg
tgcatgctgagcaacacgaccgccatcgccgaggcctgggcccgcctggaccacaagttc
gacctgatgtatgccaagagggcgtttgtgcactggtatgtgggtgagggcatggaggag
ggtgagttctccgaggcccgtgaggatatggctgccctggagaaggattatgaggaggtg
ggcatcgactcctatgaggacgaggatgagggagaagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system