KEGG   Homo sapiens (human): 7278Help
Entry
7278              CDS       T01001                                 

Gene name
TUBA3C, TUBA2, bA408E5.3
Definition
tubulin, alpha 3c
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
13q11
AA seq 450 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgtatctctatccacgtggggcaggcaggagtccagatcggcaatgcctgc
tgggaactgtactgcctggaacatggaattcagcccgatggtcagatgccaagtgataaa
accattggtggtggggacgactccttcaacacgttcttcagtgagactggagctggcaag
cacgtgcccagagcagtgtttgtggacctggagcccactgtggtcgatgaagtgcgcaca
ggaacctataggcagctcttccacccagagcagctgatcaccgggaaggaagatgcggcc
aataattacgccagaggccattacaccatcggcaaggagatcgtcgacctggtcctggac
cggatccgcaaactggcggatctgtgcacgggactgcagggcttcctcatcttccacagt
tttgggggtggcactggctctgggttcgcatctctgctcatggagcggctctcagtggat
tacggcaagaagtccaagctagaatttgccatttacccagccccccaggtctccacggcc
gtggtggagccctacaactccatcctgaccacccacacgaccctggaacattctgactgt
gccttcatggtcgacaatgaagccatctatgacatatgtcggcgcaacctggacatcgag
cgtcccacgtacaccaacctcaatcgcctgattgggcagatcgtgtcctccatcacggcc
tccctgcgatttgacggggccctgaatgtggacttgacggaattccagaccaacctagtg
ccgtacccccgcatccacttccccctggccacctacgccccggtcatctcagccgagaag
gcctaccacgagcagctgtccgtggctgagatcaccaatgcctgcttcgagccagccaat
cagatggtcaagtgtgaccctcgccacggcaagtacatggcctgctgcatgttgtacagg
ggggatgtggtcccgaaagatgtcaacgcggccatcgccaccatcaagaccaagcgcacc
atccagtttgtagattggtgcccaactggatttaaggtgggcattaactaccagcccccc
acggtggtccctgggggagacctggccaaggtgcagcgggctgtgtgcatgctgagcaac
accacggccatcgcggaggcctgggctcgcctggaccataagttcgatctcatgtatgcc
aagcgggcctttgtgcactggtacgtgggagaaggcatggaggagggggagttctctgag
gcccgcgaggacctggcagctctggagaaggattatgaagaggtgggcgtggattccgtg
gaagccgaggctgaagaaggtgaagaatactga

DBGET integrated database retrieval system