KEGG   Homo sapiens (human): 728Help
Entry
728               CDS       T01001                                 

Gene name
C5AR1, C5A, C5AR, C5R1, CD88
Definition
complement component 5a receptor 1
Orthology
K04010  
C5a anaphylatoxin chemotactic receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3-q13.4
AA seq 350 aa AA seqDB search
MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttcaattataccacccctgattatgggcactatgatgacaaggataccctg
gacctcaacacccctgtggataaaacttctaacacgctgcgtgttccagacatcctggcc
ttggtcatctttgcagtcgtcttcctggtgggagtgctgggcaatgccctggtggtctgg
gtgacggcattcgaggccaagcggaccatcaatgccatctggttcctcaacttggcggta
gccgacttcctctcctgcctggcgctgcccatcttgttcacgtccattgtacagcatcac
cactggccctttggcggggccgcctgcagcatcctgccctccctcatcctgctcaacatg
tacgccagcatcctgctcctggccaccatcagcgccgaccgctttctgctggtgtttaaa
cccatctggtgccagaacttccgaggggccggcttggcctggatcgcctgtgccgtggct
tggggtttagccctgctgctgaccataccctccttcctgtaccgggtggtccgggaggag
tactttccaccaaaggtgttgtgtggcgtggactacagccacgacaaacggcgggagcga
gccgtggccatcgtccggctggtcctgggcttcctgtggcctctactcacgctcacgatt
tgttacactttcatcctgctccggacgtggagccgcagggccacgcggtccaccaagaca
ctcaaggtggtggtggcagtggtggccagtttctttatcttctggttgccctaccaggtg
acggggataatgatgtccttcctggagccatcgtcacccaccttcctgctgctgaataag
ctggactccctgtgtgtctcctttgcctacatcaactgctgcatcaaccccatcatctac
gtggtggccggccagggcttccagggccgactgcggaaatccctccccagcctcctccgg
aacgtgttgactgaagagtccgtggttagggagagcaagtcattcacgcgctccacagtg
gacactatggcccagaagacccaggcagtgtag

DBGET integrated database retrieval system