KEGG   Homo sapiens (human): 7280Help
Entry
7280              CDS       T01001                                 

Gene name
TUBB2A, CDCBM5, TUBB, TUBB2
Definition
(RefSeq) tubulin beta 2A class IIa
  KO
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Batabulin (DG01412): 
Cabazitaxel (DG00695): 
Colchicine: 
Docetaxel (DG00694): 
Eribulin: 
Indibulin: 
Lexibulin: 
Maytansine: 
Paclitaxel: 
Paclitaxel poliglumex: 
Podophyllotoxin: 
Soblidotin: 
Taltobulin: 
Verubulin (DG01411): 
Vinblastine (DG00689): 
Vincristine (DG00690): 
Vindesine (DG00691): 
Vinepidine sulfate: 
Vinflunine: 
Vinglycinate sulfate: 
Vinleurosine sulfate: 
Vinorelbine (DG00692): 
Vinrosidine sulfate: 
Vintafolide: 
Vinzolidine sulfate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7280 (TUBB2A)
  Cellular community - eukaryotes
   04540 Gap junction
    7280 (TUBB2A)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7280 (TUBB2A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     7280 (TUBB2A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    7280 (TUBB2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7280 (TUBB2A)
  Exosomal proteins of colorectal cancer cells
   7280 (TUBB2A)
  Exosomal proteins of bladder cancer cells
   7280 (TUBB2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p25
AA seq 445 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagatcgtgcacatccaggcgggccagtgcggcaaccagatcggcgccaagttt
tgggaggtcatcagcgatgagcatgggatcgaccccacaggcagttaccatggagacagt
gacttgcagctggagagaatcaacgtgtactacaatgaggctgctggtaacaaatatgta
cctcgggccatcctggtggatctggagcctggcaccatggactctgtcaggtctggaccc
ttcggccagatcttcagaccagacaacttcgtgttcggccagagtggagccgggaataac
tgggccaagggccactacacagagggagccgagctggtcgactcggtcctggatgtggtg
aggaaggagtcagagagctgtgactgtctccagggcttccagctgacccactctctgggg
ggcggcacggggtccgggatgggcaccctgctcatcagcaagatccgggaagagtaccca
gaccgcatcatgaacaccttcagcgtcatgccctcacccaaggtgtcagacacggtggtg
gagccctacaacgccaccctctctgtccaccagctggtggaaaacacagatgaaacctac
tccattgataacgaggccctgtatgacatctgcttccgcaccctgaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgcagacctgcgcaagctggcggtgaacatggtgcccttc
cctcgcctgcacttcttcatgcccggcttcgcgcccctgaccagccggggcagccagcag
taccgggcgctcacggtgcccgagctcacccagcagatgttcgactccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgacggtggctgccatcttccggggccgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatgtcggccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgacgaacaaggggagttcgaggaggaggag
ggcgaggacgaggcttaa

DBGET integrated database retrieval system