KEGG   Homo sapiens (human): 729230Help
Entry
729230            CDS       T01001                                 

Gene name
CCR2, CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R
Definition
chemokine (C-C motif) receptor 2
Orthology
K04177  
C-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Disease
H01360  
Allergic rhinitis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    729230 (CCR2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    729230 (CCR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    729230 (CCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   729230 (CCR2)
Cellular antigens [BR:hsa04090]
 Proteins
  729230 (CCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 374 aa AA seqDB search
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccacatctcgttctcggtttatcagaaataccaacgagagcggtgaagaagtc
accaccttttttgattatgattacggtgctccctgtcataaatttgacgtgaagcaaatt
ggggcccaactcctgcctccgctctactcgctggtgttcatctttggttttgtgggcaac
atgctggtcgtcctcatcttaataaactgcaaaaagctgaagtgcttgactgacatttac
ctgctcaacctggccatctctgatctgctttttcttattactctcccattgtgggctcac
tctgctgcaaatgagtgggtctttgggaatgcaatgtgcaaattattcacagggctgtat
cacatcggttattttggcggaatcttcttcatcatcctcctgacaatcgatagatacctg
gctattgtccatgctgtgtttgctttaaaagccaggacggtcacctttggggtggtgaca
agtgtgatcacctggttggtggctgtgtttgcttctgtcccaggaatcatctttactaaa
tgccagaaagaagattctgtttatgtctgtggcccttattttccacgaggatggaataat
ttccacacaataatgaggaacattttggggctggtcctgccgctgctcatcatggtcatc
tgctactcgggaatcctgaaaaccctgcttcggtgtcgaaacgagaagaagaggcatagg
gcagtgagagtcatcttcaccatcatgattgtttactttctcttctggactccctataat
attgtcattctcctgaacaccttccaggaattcttcggcctgagtaactgtgaaagcacc
agtcaactggaccaagccacgcaggtgacagagactcttgggatgactcactgctgcatc
aatcccatcatctatgccttcgttggggagaagttcagaagcctttttcacatagctctt
ggctgtaggattgccccactccaaaaaccagtgtgtggaggtccaggagtgagaccagga
aagaatgtgaaagtgactacacaaggactcctcgatggtcgtggaaaaggaaagtcaatt
ggcagagcccctgaagccagtcttcaggacaaagaaggagcctag

DBGET integrated database retrieval system