KEGG   Homo sapiens (human): 7311Help
Entry
7311              CDS       T01001                                 

Gene name
UBA52, CEP52, HUBCEP52, L40, RPL40
Definition
ubiquitin A-52 residue ribosomal protein fusion product 1
Orthology
K02927  
large subunit ribosomal protein L40e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Class
Genetic Information Processing; Translation; Ribosome [PATH:hsa03010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.1-p12
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctcactggcaaaaccatcacccttgaggtcgagcccagt
gacaccattgagaatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag
cagcgtctgatatttgccggcaaacagctggaggatggccgcactctctcagactacaac
atccagaaagagtccaccctgcacctggtgttgcgcctgcgaggtggcattattgagcct
tctctccgccagcttgcccagaaatacaactgcgacaagatgatctgccgcaagtgctat
gctcgccttcaccctcgtgctgtcaactgccgcaagaagaagtgtggtcacaccaacaac
ctgcgtcccaagaagaaggtcaaataa

DBGET integrated database retrieval system