KEGG   Homo sapiens (human): 7314Help
Entry
7314              CDS       T01001                                 

Gene name
UBB
Definition
ubiquitin B
Orthology
K04551  
ubiquitin B
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7314 (UBB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7314 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   7314 (UBB)
  Exosomal proteins of colorectal cancer cells
   7314 (UBB)
  Exosomal proteins of bladder cancer cells
   7314 (UBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
3NHE 1OGW 4IUM 1XD3 3BY4 2GBM 2ZCB 2GBN 4I6N 3VUX 3V6C 3B08 3PRP 3NS8 4K7S 4K7U 4K7W 3N32 3ONS 3K9O 1UBI 1UBQ 3EHV 3EFU 3ALB 3MHS 4LDT 3ZNZ 3B0A 3H7P 3TMP 3VUW 2JF5 3HM3 3VUY 2GBK 2G45 4IG7 3PHW 2GBR 1S1Q 4FJV 3V6E 4AUQ 3AXC 3NOB 2XEW 3A33 2O6V 2IBI 3ZNI 4AP4 2W9N 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 4BOS 4DHJ 3UGB 3OFI 3AUL 4KSK 3IFW 1TBE 3U30 3RUL 3PT2 3OJ3 2GMI 3I3T 3DVG 2OJR 4MDK 4BVU 2Y5B 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 3VFK 3KVF 3K9P 3IHP 4KSL 3KW5 4HXD 4JQW 3ZLZ 3TBL 2ZVO 3PHD 2XK5 3N30 2ZVN 3EEC 4BOZ 4LCD 3JW0 4DHZ 4DDG 3JVZ 3OJ4 2AYO 4JIO 4NQK 4DDI 2MJB 2RU6 2MCN 2MBQ 2MBO 2MBH 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2LD9 2L3Z 2L0T 2L0F 2RR9 2KX0 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2K25 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1GJZ 1G6J 1FXT 1D3Z
Thumbnails

Jmol
Position
17p12-p11.2
AA seq 229 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagt
gacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcattccccccgaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaac
atccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag
tcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaagataaagaaggcatcccccccgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcac
ctggtcctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system