KEGG   Homo sapiens (human): 7341Help
Entry
7341              CDS       T01001                                 

Gene name
SUMO1, DAP1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1
Definition
small ubiquitin-like modifier 1
Orthology
K12160  
small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Disease
H00516  
Isolated orofacial clefts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    7341 (SUMO1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     7341 (SUMO1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    7341 (SUMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttgggggataagaaggaaggtgaa
tatattaaactcaaagtcattggacaggatagcagtgagattcacttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggtgttccaatgaat
tcactcaggtttctctttgagggtcagagaattgctgataatcatactccaaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacggggggtcattcaaca
gtttag

DBGET integrated database retrieval system