KEGG   Homo sapiens (human): 7409Help
Entry
7409              CDS       T01001                                 

Gene name
VAV1, VAV
Definition
(RefSeq) vav guanine nucleotide exchange factor 1
  KO
K05730  
guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    7409 (VAV1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    7409 (VAV1)
  Cellular commiunity
   04510 Focal adhesion
    7409 (VAV1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    7409 (VAV1)
   04660 T cell receptor signaling pathway
    7409 (VAV1)
   04662 B cell receptor signaling pathway
    7409 (VAV1)
   04664 Fc epsilon RI signaling pathway
    7409 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    7409 (VAV1)
   04670 Leukocyte transendothelial migration
    7409 (VAV1)
   04062 Chemokine signaling pathway
    7409 (VAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 845 aa AA seqDB search
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtggcgccaatgcacccactggctcatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctgtgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaagttcggcctcaagcggagcgagctcttcgaagcctttgacctcttc
gatgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatc
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgacaagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacactgacacgctgggctccatccagcagcatttc
ttgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggttcctcgtctat
ggccgctactgcagccaggtggagtcagccagcaaacacctggaccgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagagagccaacaacgggaggttc
accctgcgggacctgctgatggtgcctatgcagcgagttctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggaggcgatggagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cgacagatcaccaatttccagctgtccattgagaacctggaccagtctctggctcactat
ggccggcccaagatcgacggggaactcaagatcacctcggtggaacggcgctccaagatg
gacaggtatgccttcctgctcgacaaagctctactcatctgtaagcgcaggggagactcc
tatgacctcaaggactttgtaaacctgcacagcttccaggttcgggatgactcttcagga
gaccgagacaacaagaagtggagccacatgttcctcctgatcgaggaccaaggtgcccag
ggctatgagctgttcttcaagacaagagaattgaagaagaagtggatggagcagtttgag
atggccatctccaacatctatccggagaatgccaccgccaacgggcatgacttccagatg
ttctcctttgaggagaccacatcctgcaaggcctgtcagatgctgcttagaggtaccttc
tatcagggctaccgctgccatcggtgccgggcatctgcacacaaggagtgtctggggagg
gtccctccatgtggccgacatgggcaagatttcccaggaactatgaagaaggacaaacta
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttt
caggaatactacgggcttcctccaccccctggagccattggaccctttctacggctcaac
cctggagacattgtggagctcacgaaggctgaggctgaacagaactggtgggagggcaga
aatacatctactaatgaaattggctggtttccttgtaacagggtgaagccctatgtccat
ggccctcctcaggacctgtctgttcatctctggtacgcaggccccatggagcgggcaggg
gcagagagcatcctggccaaccgctcggacgggactttcttggtgcggcagagggtgaag
gatgcagcagaatttgccatcagcattaaatataacgtcgaggtcaagcacattaaaatc
atgacagcagaaggactgtaccggatcacagagaaaaaggctttccgggggcttacggag
ctggtggagttttaccagcagaactctctaaaggattgcttcaagtctctggacaccacc
ttgcagttccccttcaaggagcctgaaaagagaaccatcagcaggccagcagtgggaagc
acaaagtattttggcacagccaaagcccgctatgacttctgcgcccgagaccgatcagag
ctgtcgctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctgg
tggcgaggggagatctatggccgggttggctggttccctgccaactacgtggaggaagat
tattctgaatactgctga

DBGET integrated database retrieval system