KEGG   Homo sapiens (human): 7409Help
Entry
7409              CDS       T01001                                 

Gene name
VAV1, VAV
Definition
(RefSeq) vav guanine nucleotide exchange factor 1
  KO
K05730  
guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    7409 (VAV1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7409 (VAV1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    7409 (VAV1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    7409 (VAV1)
   04660 T cell receptor signaling pathway
    7409 (VAV1)
   04662 B cell receptor signaling pathway
    7409 (VAV1)
   04664 Fc epsilon RI signaling pathway
    7409 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    7409 (VAV1)
   04670 Leukocyte transendothelial migration
    7409 (VAV1)
   04062 Chemokine signaling pathway
    7409 (VAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P15498(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 845 aa AA seqDB search
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtggcgccaatgcacccactggctcatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctgtgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaagttcggcctcaagcggagcgagctcttcgaagcctttgacctcttc
gatgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatc
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgacaagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacactgacacgctgggctccatccagcagcatttc
ttgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggttcctcgtctat
ggccgctactgcagccaggtggagtcagccagcaaacacctggaccgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagagagccaacaacgggaggttc
accctgcgggacctgctgatggtgcctatgcagcgagttctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggaggcgatggagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cgacagatcaccaatttccagctgtccattgagaacctggaccagtctctggctcactat
ggccggcccaagatcgacggggaactcaagatcacctcggtggaacggcgctccaagatg
gacaggtatgccttcctgctcgacaaagctctactcatctgtaagcgcaggggagactcc
tatgacctcaaggactttgtaaacctgcacagcttccaggttcgggatgactcttcagga
gaccgagacaacaagaagtggagccacatgttcctcctgatcgaggaccaaggtgcccag
ggctatgagctgttcttcaagacaagagaattgaagaagaagtggatggagcagtttgag
atggccatctccaacatctatccggagaatgccaccgccaacgggcatgacttccagatg
ttctcctttgaggagaccacatcctgcaaggcctgtcagatgctgcttagaggtaccttc
tatcagggctaccgctgccatcggtgccgggcatctgcacacaaggagtgtctggggagg
gtccctccatgtggccgacatgggcaagatttcccaggaactatgaagaaggacaaacta
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttt
caggaatactacgggcttcctccaccccctggagccattggaccctttctacggctcaac
cctggagacattgtggagctcacgaaggctgaggctgaacagaactggtgggagggcaga
aatacatctactaatgaaattggctggtttccttgtaacagggtgaagccctatgtccat
ggccctcctcaggacctgtctgttcatctctggtacgcaggccccatggagcgggcaggg
gcagagagcatcctggccaaccgctcggacgggactttcttggtgcggcagagggtgaag
gatgcagcagaatttgccatcagcattaaatataacgtcgaggtcaagcacattaaaatc
atgacagcagaaggactgtaccggatcacagagaaaaaggctttccgggggcttacggag
ctggtggagttttaccagcagaactctctaaaggattgcttcaagtctctggacaccacc
ttgcagttccccttcaaggagcctgaaaagagaaccatcagcaggccagcagtgggaagc
acaaagtattttggcacagccaaagcccgctatgacttctgcgcccgagaccgatcagag
ctgtcgctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctgg
tggcgaggggagatctatggccgggttggctggttccctgccaactacgtggaggaagat
tattctgaatactgctga

DBGET integrated database retrieval system