KEGG   Homo sapiens (human): 7409Help
Entry
7409              CDS       T01001                                 

Gene name
VAV1, VAV
Definition
vav 1 guanine nucleotide exchange factor
Orthology
K05730  
guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 823 aa AA seqDB search
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGPPQDLSVHLWYAGPMERAGAE
SILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELV
EFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELS
LKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtggcgccaatgcacccactggctcatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctgtgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaagttcggcctcaagcggagcgagctcttcgaagcctttgacctcttc
gatgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatc
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgacaagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacactgacacgctgggctccatccagcagcatttc
ttgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggttcctcgtctat
ggccgctactgcagccaggtggagtcagccagcaaacacctggaccgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagagagccaacaacgggaggttc
accctgcgggacctgctgatggtgcctatgcagcgagttctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggaggcgatggagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cgacagatcaccaatttccagctgtccattgagaacctggaccagtctctggctcactat
ggccggcccaagatcgacggggaactcaagatcacctcggtggaacggcgctccaagatg
gacaggtatgccttcctgctcgacaaagctctactcatctgtaagcgcaggggagactcc
tatgacctcaaggactttgtaaacctgcacagcttccaggttcgggatgactcttcagga
gaccgagacaacaagaagtggagccacatgttcctcctgatcgaggaccaaggtgcccag
ggctatgagctgttcttcaagacaagagaattgaagaagaagtggatggagcagtttgag
atggccatctccaacatctatccggagaatgccaccgccaacgggcatgacttccagatg
ttctcctttgaggagaccacatcctgcaaggcctgtcagatgctgcttagaggtaccttc
tatcagggctaccgctgccatcggtgccgggcatctgcacacaaggagtgtctggggagg
gtccctccatgtggccgacatgggcaagatttcccaggaactatgaagaaggacaaacta
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttt
caggaatactacgggcttcctccaccccctggagccattggaccctttctacggctcaac
cctggagacattgtggagctcacgaaggctgaggctgaacagaactggtgggagggccct
cctcaggacctgtctgttcatctctggtacgcaggccccatggagcgggcaggggcagag
agcatcctggccaaccgctcggacgggactttcttggtgcggcagagggtgaaggatgca
gcagaatttgccatcagcattaaatataacgtcgaggtcaagcacattaaaatcatgaca
gcagaaggactgtaccggatcacagagaaaaaggctttccgggggcttacggagctggtg
gagttttaccagcagaactctctaaaggattgcttcaagtctctggacaccaccttgcag
ttccccttcaaggagcctgaaaagagaaccatcagcaggccagcagtgggaagcacaaag
tattttggcacagccaaagcccgctatgacttctgcgcccgagaccgatcagagctgtcg
ctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctggtggcga
ggggagatctatggccgggttggctggttccctgccaactacgtggaggaagattattct
gaatactgctga

DBGET integrated database retrieval system