KEGG   Homo sapiens (human): 7410Help
Entry
7410              CDS       T01001                                 

Gene name
VAV2, VAV-2
Definition
(RefSeq) vav guanine nucleotide exchange factor 2
  KO
K05730  
guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    7410 (VAV2)
   04024 cAMP signaling pathway
    7410 (VAV2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7410 (VAV2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    7410 (VAV2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    7410 (VAV2)
   04660 T cell receptor signaling pathway
    7410 (VAV2)
   04662 B cell receptor signaling pathway
    7410 (VAV2)
   04664 Fc epsilon RI signaling pathway
    7410 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    7410 (VAV2)
   04670 Leukocyte transendothelial migration
    7410 (VAV2)
   04062 Chemokine signaling pathway
    7410 (VAV2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7410 (VAV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P52735(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.2
AA seq 878 aa AA seqDB search
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgattgcaaggtcctgccgcccaac
caccgggtggtgtggccctcggccgtggtcttcgacctggcgcaggcgctgcgcgacggg
gtccttctgtgccagctgctgcacaacctctcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagtttctgtgtttgaagaacatacgcaccttcctgaaa
gtctgccacgataaatttggattaaggaacagcgagctgtttgacccctttgacctcttc
gatgtgcgagactttggaaaggtcatctccgcggtgtcgaggctctccctgcacagcatc
gcgcagaacaaagggatcaggccttttccctcagaggagaccacagagaatgacgatgac
gtctaccgcagcctggaggagctggccgacgagcatgacctgggggaggacatctacgac
tgcgtcccgtgtgaggatggaggggacgacatctacgaggacatcatcaaggtggaggtg
cagcagcccatgattagatacatgcagaaaatgggcatgactgaagatgacaagaggaac
tgctgcctgctggagatccaggagaccgaggccaagtactaccgcaccctggaggacatt
gagaagaactacatgagccccctgcggctggtgctgagcccggcggacatggcagctgtc
ttcattaacctggaggacctgatcaaggtgcatcacagcttcctgagggccatcgacgtg
tccgtgatggtggggggcagcacgctggccaaggtcttcctcgatttcaaggaaaggctt
ctgatctacggggagtactgcagccacatggagcacgcccagaacacactgaaccagctc
ctggccagccgggaggacttcaggcagaaagtcgaggagtgcacactgaaggtccaggat
ggaaaatttaagctgcaagacctgctggtggtccccatgcagagggtgctcaaataccac
ctgctcttgaaggagcttctgagccattctgcggaacggcctgagaggcagcagctcaaa
gaagcactggaagccatgcaggacttggcgatgtacatcaatgaagttaaacgggacaag
gagaccttgaggaaaatcagcgaatttcagagttctatagaaaatttgcaagtgaaactg
gaggaatttggaagaccaaagattgacggggaactgaaagtccggtccatagtcaaccac
accaagcaggacaggtacttgttcctgtttgacaaggtggtcatcgtctgcaagcggaag
ggctacagctacgagctcaaggagatcatcgagctgctgttccacaagatgaccgacgac
cccatgaacaacaaggacgtcaagaagtctcacgggaaaatgtggtcctacggcttctac
ctaattcaccttcaaggaaagcagggcttccagtttttctgcaaaacagaagatatgaag
aggaagtggatggagcagtttgagatggccatgtcaaacatcaagccagacaaagccaat
gccaaccaccacagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgc
aaaatgttcctcaggggcaccttctaccagggatacatgtgtaccaagtgtggcgtcggg
gcacacaaggagtgcctggaagtgatacctccctgcaagttcacttctcctgcagatctg
gacgcctccggagcgggaccaggtcccaagatggtggccatgcagaattaccatggcaac
ccagcccctcccgggaagcctgtgctgaccttccagacgggcgacgtgcttgagctgctg
aggggcgaccctgagtctccgtggtgggagggtcgtctggtacaaaccaggaagtcaggg
tatttccccagctcatctgtgaagccctgccctgtggatggaaggccgcccatcagccgg
ccgccatcccgggagatcgactacactgcatacccctggtttgcaggtaacatggagagg
cagcagacggacaacctgctcaagtcccacgccagcgggacctacctgatcagggagcgg
cctgccgaggctgagcgctttgcaataagcatcaagttcaatgatgaggtgaagcacatc
aaggtggtggagaaggacaactggatccacatcacagaggccaagaaattcgacagcctc
ctggagttggtggagtactaccagtgccactcactgaaggagagcttcaagcagctggac
accacactcaagtacccctacaagtcccgggaacgttcggcctccagggcctccagccgg
tccccagcttcctgtgcttcctacaacttttcttttctcagtcctcagggcctcagcttt
gcttctcagggcccctccgctcccttctggtcagtgttcacgccccgcgtcatcggcaca
gctgtggccaggtataactttgccgcccgagatatgagggagctttcgctgcgggagggt
gacgtggtgaggatctacagccgcatcggcggagaccagggctggtggaagggcgagacc
aacggacggattggctggtttccttcaacgtacgtagaagaggagggcatccagtga

DBGET integrated database retrieval system