KEGG   Homo sapiens (human): 7410Help
Entry
7410              CDS       T01001                                 

Gene name
VAV2, VAV-2
Definition
(RefSeq) vav guanine nucleotide exchange factor 2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    7410 (VAV2)
   04024 cAMP signaling pathway
    7410 (VAV2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7410 (VAV2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    7410 (VAV2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    7410 (VAV2)
   04660 T cell receptor signaling pathway
    7410 (VAV2)
   04662 B cell receptor signaling pathway
    7410 (VAV2)
   04664 Fc epsilon RI signaling pathway
    7410 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    7410 (VAV2)
   04670 Leukocyte transendothelial migration
    7410 (VAV2)
   04062 Chemokine signaling pathway
    7410 (VAV2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7410 (VAV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH SH2_2 CDC24 C1_2 PH_10 Zn_ribbon_17 zf-RING-like
Motif
Other DBs
NCBI-GeneID: 7410
NCBI-ProteinID: NP_001127870
OMIM: 600428
HGNC: 12658
Ensembl: ENSG00000160293
Vega: OTTHUMG00000020882
Pharos: P52735(Tbio)
UniProt: P52735
Structure
PDB: 

Jmol
Position
9q34.2
AA seq 878 aa AA seqDB search
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgattgcaaggtcctgccgcccaac
caccgggtggtgtggccctcggccgtggtcttcgacctggcgcaggcgctgcgcgacggg
gtccttctgtgccagctgctgcacaacctctcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagtttctgtgtttgaagaacatacgcaccttcctgaaa
gtctgccacgataaatttggattaaggaacagcgagctgtttgacccctttgacctcttc
gatgtgcgagactttggaaaggtcatctccgcggtgtcgaggctctccctgcacagcatc
gcgcagaacaaagggatcaggccttttccctcagaggagaccacagagaatgacgatgac
gtctaccgcagcctggaggagctggccgacgagcatgacctgggggaggacatctacgac
tgcgtcccgtgtgaggatggaggggacgacatctacgaggacatcatcaaggtggaggtg
cagcagcccatgattagatacatgcagaaaatgggcatgactgaagatgacaagaggaac
tgctgcctgctggagatccaggagaccgaggccaagtactaccgcaccctggaggacatt
gagaagaactacatgagccccctgcggctggtgctgagcccggcggacatggcagctgtc
ttcattaacctggaggacctgatcaaggtgcatcacagcttcctgagggccatcgacgtg
tccgtgatggtggggggcagcacgctggccaaggtcttcctcgatttcaaggaaaggctt
ctgatctacggggagtactgcagccacatggagcacgcccagaacacactgaaccagctc
ctggccagccgggaggacttcaggcagaaagtcgaggagtgcacactgaaggtccaggat
ggaaaatttaagctgcaagacctgctggtggtccccatgcagagggtgctcaaataccac
ctgctcttgaaggagcttctgagccattctgcggaacggcctgagaggcagcagctcaaa
gaagcactggaagccatgcaggacttggcgatgtacatcaatgaagttaaacgggacaag
gagaccttgaggaaaatcagcgaatttcagagttctatagaaaatttgcaagtgaaactg
gaggaatttggaagaccaaagattgacggggaactgaaagtccggtccatagtcaaccac
accaagcaggacaggtacttgttcctgtttgacaaggtggtcatcgtctgcaagcggaag
ggctacagctacgagctcaaggagatcatcgagctgctgttccacaagatgaccgacgac
cccatgaacaacaaggacgtcaagaagtctcacgggaaaatgtggtcctacggcttctac
ctaattcaccttcaaggaaagcagggcttccagtttttctgcaaaacagaagatatgaag
aggaagtggatggagcagtttgagatggccatgtcaaacatcaagccagacaaagccaat
gccaaccaccacagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgc
aaaatgttcctcaggggcaccttctaccagggatacatgtgtaccaagtgtggcgtcggg
gcacacaaggagtgcctggaagtgatacctccctgcaagttcacttctcctgcagatctg
gacgcctccggagcgggaccaggtcccaagatggtggccatgcagaattaccatggcaac
ccagcccctcccgggaagcctgtgctgaccttccagacgggcgacgtgcttgagctgctg
aggggcgaccctgagtctccgtggtgggagggtcgtctggtacaaaccaggaagtcaggg
tatttccccagctcatctgtgaagccctgccctgtggatggaaggccgcccatcagccgg
ccgccatcccgggagatcgactacactgcatacccctggtttgcaggtaacatggagagg
cagcagacggacaacctgctcaagtcccacgccagcgggacctacctgatcagggagcgg
cctgccgaggctgagcgctttgcaataagcatcaagttcaatgatgaggtgaagcacatc
aaggtggtggagaaggacaactggatccacatcacagaggccaagaaattcgacagcctc
ctggagttggtggagtactaccagtgccactcactgaaggagagcttcaagcagctggac
accacactcaagtacccctacaagtcccgggaacgttcggcctccagggcctccagccgg
tccccagcttcctgtgcttcctacaacttttcttttctcagtcctcagggcctcagcttt
gcttctcagggcccctccgctcccttctggtcagtgttcacgccccgcgtcatcggcaca
gctgtggccaggtataactttgccgcccgagatatgagggagctttcgctgcgggagggt
gacgtggtgaggatctacagccgcatcggcggagaccagggctggtggaagggcgagacc
aacggacggattggctggtttccttcaacgtacgtagaagaggagggcatccagtga

DBGET integrated database retrieval system