KEGG   Homo sapiens (human): 7412Help
Entry
7412              CDS       T01001                                 

Gene name
VCAM1, CD106, INCAM-100
Definition
vascular cell adhesion molecule 1
Orthology
K06527  
vascular cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
TNF signaling pathway
Leukocyte transendothelial migration
African trypanosomiasis
Malaria
HTLV-I infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32-p31
AA seq 739 aa AA seqDB search
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagatggtcgtgatccttggagcctcaaatatactttggataatgtttgca
gcttctcaagcttttaaaatcgagaccaccccagaatctagatatcttgctcagattggt
gactccgtctcattgacttgcagcaccacaggctgtgagtccccatttttctcttggaga
acccagatagatagtccactgaatgggaaggtgacgaatgaggggaccacatctacgctg
acaatgaatcctgttagttttgggaacgaacactcttacctgtgcacagcaacttgtgaa
tctaggaaattggaaaaaggaatccaggtggagatctactcttttcctaaggatccagag
attcatttgagtggccctctggaggctgggaagccgatcacagtcaagtgttcagttgct
gatgtatacccatttgacaggctggagatagacttactgaaaggagatcatctcatgaag
agtcaggaatttctggaggatgcagacaggaagtccctggaaaccaagagtttggaagta
acctttactcctgtcattgaggatattggaaaagttcttgtttgccgagctaaattacac
attgatgaaatggattctgtgcccacagtaaggcaggctgtaaaagaattgcaagtctac
atatcacccaagaatacagttatttctgtgaatccatccacaaagctgcaagaaggtggc
tctgtgaccatgacctgttccagcgagggtctaccagctccagagattttctggagtaag
aaattagataatgggaatctacagcacctttctggaaatgcaactctcaccttaattgct
atgaggatggaagattctggaatttatgtgtgtgaaggagttaatttgattgggaaaaac
agaaaagaggtggaattaattgttcaagagaaaccatttactgttgagatctcccctgga
ccccggattgctgctcagattggagactcagtcatgttgacatgtagtgtcatgggctgt
gaatccccatctttctcctggagaacccagatagacagccctctgagcgggaaggtgagg
agtgaggggaccaattccacgctgaccctgagccctgtgagttttgagaacgaacactct
tatctgtgcacagtgacttgtggacataagaaactggaaaagggaatccaggtggagctc
tactcattccctagagatccagaaatcgagatgagtggtggcctcgtgaatgggagctct
gtcactgtaagctgcaaggttcctagcgtgtacccccttgaccggctggagattgaatta
cttaagggggagactattctggagaatatagagtttttggaggatacggatatgaaatct
ctagagaacaaaagtttggaaatgaccttcatccctaccattgaagatactggaaaagct
cttgtttgtcaggctaagttacatattgatgacatggaattcgaacccaaacaaaggcag
agtacgcaaacactttatgtcaatgttgcccccagagatacaaccgtcttggtcagccct
tcctccatcctggaggaaggcagttctgtgaatatgacatgcttgagccagggctttcct
gctccgaaaatcctgtggagcaggcagctccctaacggggagctacagcctctttctgag
aatgcaactctcaccttaatttctacaaaaatggaagattctggggtttatttatgtgaa
ggaattaaccaggctggaagaagcagaaaggaagtggaattaattatccaagttactcca
aaagacataaaacttacagcttttccttctgagagtgtcaaagaaggagacactgtcatc
atctcttgtacatgtggaaatgttccagaaacatggataatcctgaagaaaaaagcggag
acaggagacacagtactaaaatctatagatggcgcctataccatccgaaaggcccagttg
aaggatgcgggagtatatgaatgtgaatctaaaaacaaagttggctcacaattaagaagt
ttaacacttgatgttcaaggaagagaaaacaacaaagactatttttctcctgagcttctc
gtgctctattttgcatcctccttaataatacctgccattggaatgataatttactttgca
agaaaagccaacatgaaggggtcatatagtcttgtagaagcacagaagtcaaaagtgtag

DBGET integrated database retrieval system