KEGG   Homo sapiens (human): 7412Help
Entry
7412              CDS       T01001                                 

Gene name
VCAM1, CD106, INCAM-100
Definition
(RefSeq) vascular cell adhesion molecule 1
  KO
K06527  
vascular cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
TNF signaling pathway
Leukocyte transendothelial migration
AGE-RAGE signaling pathway in diabetic complications
African trypanosomiasis
Malaria
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7412 (VCAM1)
   04668 TNF signaling pathway
    7412 (VCAM1)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    7412 (VCAM1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7412 (VCAM1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7412 (VCAM1)
  Infectious diseases
   05166 HTLV-I infection
    7412 (VCAM1)
   05144 Malaria
    7412 (VCAM1)
   05143 African trypanosomiasis
    7412 (VCAM1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     7412 (VCAM1)
   VLA-9
     7412 (VCAM1)
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     7412 (VCAM1)
   alpha D beta 2
     7412 (VCAM1)
  Beta7 integrins
   alpha 4 beta 7
    ITGB7; integrin beta 7 [KO:K06590]
     7412 (VCAM1)
Cellular antigens [BR:hsa04090]
 Proteins
  7412 (VCAM1)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  7412 (VCAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32-p31
AA seq 739 aa AA seqDB search
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagatggtcgtgatccttggagcctcaaatatactttggataatgtttgca
gcttctcaagcttttaaaatcgagaccaccccagaatctagatatcttgctcagattggt
gactccgtctcattgacttgcagcaccacaggctgtgagtccccatttttctcttggaga
acccagatagatagtccactgaatgggaaggtgacgaatgaggggaccacatctacgctg
acaatgaatcctgttagttttgggaacgaacactcttacctgtgcacagcaacttgtgaa
tctaggaaattggaaaaaggaatccaggtggagatctactcttttcctaaggatccagag
attcatttgagtggccctctggaggctgggaagccgatcacagtcaagtgttcagttgct
gatgtatacccatttgacaggctggagatagacttactgaaaggagatcatctcatgaag
agtcaggaatttctggaggatgcagacaggaagtccctggaaaccaagagtttggaagta
acctttactcctgtcattgaggatattggaaaagttcttgtttgccgagctaaattacac
attgatgaaatggattctgtgcccacagtaaggcaggctgtaaaagaattgcaagtctac
atatcacccaagaatacagttatttctgtgaatccatccacaaagctgcaagaaggtggc
tctgtgaccatgacctgttccagcgagggtctaccagctccagagattttctggagtaag
aaattagataatgggaatctacagcacctttctggaaatgcaactctcaccttaattgct
atgaggatggaagattctggaatttatgtgtgtgaaggagttaatttgattgggaaaaac
agaaaagaggtggaattaattgttcaagagaaaccatttactgttgagatctcccctgga
ccccggattgctgctcagattggagactcagtcatgttgacatgtagtgtcatgggctgt
gaatccccatctttctcctggagaacccagatagacagccctctgagcgggaaggtgagg
agtgaggggaccaattccacgctgaccctgagccctgtgagttttgagaacgaacactct
tatctgtgcacagtgacttgtggacataagaaactggaaaagggaatccaggtggagctc
tactcattccctagagatccagaaatcgagatgagtggtggcctcgtgaatgggagctct
gtcactgtaagctgcaaggttcctagcgtgtacccccttgaccggctggagattgaatta
cttaagggggagactattctggagaatatagagtttttggaggatacggatatgaaatct
ctagagaacaaaagtttggaaatgaccttcatccctaccattgaagatactggaaaagct
cttgtttgtcaggctaagttacatattgatgacatggaattcgaacccaaacaaaggcag
agtacgcaaacactttatgtcaatgttgcccccagagatacaaccgtcttggtcagccct
tcctccatcctggaggaaggcagttctgtgaatatgacatgcttgagccagggctttcct
gctccgaaaatcctgtggagcaggcagctccctaacggggagctacagcctctttctgag
aatgcaactctcaccttaatttctacaaaaatggaagattctggggtttatttatgtgaa
ggaattaaccaggctggaagaagcagaaaggaagtggaattaattatccaagttactcca
aaagacataaaacttacagcttttccttctgagagtgtcaaagaaggagacactgtcatc
atctcttgtacatgtggaaatgttccagaaacatggataatcctgaagaaaaaagcggag
acaggagacacagtactaaaatctatagatggcgcctataccatccgaaaggcccagttg
aaggatgcgggagtatatgaatgtgaatctaaaaacaaagttggctcacaattaagaagt
ttaacacttgatgttcaaggaagagaaaacaacaaagactatttttctcctgagcttctc
gtgctctattttgcatcctccttaataatacctgccattggaatgataatttactttgca
agaaaagccaacatgaaggggtcatatagtcttgtagaagcacagaagtcaaaagtgtag

DBGET integrated database retrieval system