KEGG   Homo sapiens (human): 7416Help
Entry
7416              CDS       T01001                                 

Gene name
VDAC1, PORIN, VDAC-1
Definition
(RefSeq) voltage dependent anion channel 1
  KO
K05862  
voltage-dependent anion channel protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Necroptosis
Cellular senescence
NOD-like receptor signaling pathway
Cholesterol metabolism
Parkinson's disease
Huntington's disease
Influenza A
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7416 (VDAC1)
   04022 cGMP - PKG signaling pathway
    7416 (VDAC1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    7416 (VDAC1)
   04218 Cellular senescence
    7416 (VDAC1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7416 (VDAC1)
  Digestive system
   04979 Cholesterol metabolism
    7416 (VDAC1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7416 (VDAC1)
   05016 Huntington's disease
    7416 (VDAC1)
  Infectious diseases
   05166 HTLV-I infection
    7416 (VDAC1)
   05164 Influenza A
    7416 (VDAC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7416 (VDAC1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   7416 (VDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P21796(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 283 aa AA seqDB search
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccacccacgtatgccgatcttggcaaatctgccagggatgtcttcaccaag
ggctatggatttggcttaataaagcttgatttgaaaacaaaatctgagaatggattggaa
tttacaagctcaggctcagccaacactgagaccaccaaagtgacgggcagtctggaaacc
aagtacagatggactgagtacggcctgacgtttacagagaaatggaataccgacaataca
ctaggcaccgagattactgtggaagatcagcttgcacgtggactgaagctgaccttcgat
tcatccttctcacctaacactgggaaaaaaaatgctaaaatcaagacagggtacaagcgg
gagcacattaacctgggctgcgacatggatttcgacattgctgggccttccatccggggt
gctctggtgctaggttacgagggctggctggccggctaccagatgaattttgagactgca
aaatcccgagtgacccagagcaactttgcagttggctacaagactgatgaattccagctt
cacactaatgtgaatgacgggacagagtttggcggctccatttaccagaaagtgaacaag
aagttggagaccgctgtcaatcttgcctggacagcaggaaacagtaacacgcgcttcgga
atagcagccaagtatcagattgaccctgacgcctgcttctcggctaaagtgaacaactcc
agcctgataggtttaggatacactcagactctaaagccaggtattaaactgacactgtca
gctcttctggatggcaagaacgtcaatgctggtggccacaagcttggtctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system